PDB entry 7b3k

View 7b3k on RCSB PDB site
Description: dynamic complex between all-d-enantiomeric peptide d3 with l723p mutant of amyloid precursor protein (app) 672-726 fragment (amyloid beta 1-55)
Deposited on 2020-12-01, released 2021-01-13
The last revision was dated 2021-12-08, with a file datestamp of 2021-12-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Isoform L-APP677 of Amyloid-beta precursor protein
  Species: Homo sapiens [TaxId:9606]
  Gene: APP, A4, AD1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P05067 (0-54)
    • engineered mutation (51)
• Chain 'B':
  Compound: D3 all D-enantimeric peptide
  Species: synthetic construct, synthetic [TaxId:32630]
  
• Heterogens: 2TL, DAR, DHI, DLE, DSG, DPR

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records:
  

  >7b3kA (A:)
  daefrhdsgyevhhqklvffaedvgsnkgaiiglmvggvviatvivitlvmpkkk
  

  
  
• Chain 'B':
  No sequence available.