PDB entry 7ayn

View 7ayn on RCSB PDB site
Description: Crystal structure of the lectin domain of the FimH variant Arg98Ala, in complex with Methyl 3-chloro-4-D-mannopyranosyloxy-3-biphenylcarboxylate
Class: cell adhesion
Keywords: adhesin, FimH, UPEC, bladder infection, carbohydrate, lectin, CELL ADHESION
Deposited on 2020-11-12, released 2020-12-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-12-30, with a file datestamp of 2020-12-25.
Experiment type: XRAY
Resolution: 1.42 Å
R-factor: N/A
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Type 1 fimbrin D-mannose specific adhesin
    Species: Escherichia coli K12 [TaxId:83333]
    Gene: fimH, b4320, JW4283
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08191 (0-157)
      • engineered mutation (97)
    Domains in SCOPe 2.08: d7ayna_
  • Chain 'B':
    Compound: Type 1 fimbrin D-mannose specific adhesin
    Species: Escherichia coli K12 [TaxId:83333]
    Gene: fimH, b4320, JW4283
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08191 (0-157)
      • engineered mutation (97)
    Domains in SCOPe 2.08: d7aynb_
  • Chain 'C':
    Compound: Type 1 fimbrin D-mannose specific adhesin
    Species: Escherichia coli K12 [TaxId:83333]
    Gene: fimH, b4320, JW4283
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08191 (0-157)
      • engineered mutation (97)
    Domains in SCOPe 2.08: d7aync_
  • Chain 'D':
    Compound: Type 1 fimbrin D-mannose specific adhesin
    Species: Escherichia coli K12 [TaxId:83333]
    Gene: fimH, b4320, JW4283
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08191 (0-157)
      • engineered mutation (97)
    Domains in SCOPe 2.08: d7aynd_
  • Heterogens: SBQ, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >7aynA (A:)
facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
gsayggvlsnfsgtvkysgssypfpttsetprvvynsatdkpwpvalyltpvssaggvai
kagsliavlilrqtnnynsddfqfvwniyanndvvvpt

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >7aynB (B:)
facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
gsayggvlsnfsgtvkysgssypfpttsetprvvynsatdkpwpvalyltpvssaggvai
kagsliavlilrqtnnynsddfqfvwniyanndvvvpt

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >7aynC (C:)
facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
gsayggvlsnfsgtvkysgssypfpttsetprvvynsatdkpwpvalyltpvssaggvai
kagsliavlilrqtnnynsddfqfvwniyanndvvvpt

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >7aynD (D:)
facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
gsayggvlsnfsgtvkysgssypfpttsetprvvynsatdkpwpvalyltpvssaggvai
kagsliavlilrqtnnynsddfqfvwniyanndvvvpt