PDB entry 7ava

View 7ava on RCSB PDB site
Description: solution structure of the fluorogen-activating protein fast in complex with the ligand n871b
Deposited on 2020-11-05, released 2021-04-28
The last revision was dated 2021-06-09, with a file datestamp of 2021-06-04.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fast
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 7AVA (0-137)
  • Heterogens: S1Q

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >7avaA (A:)
mehvafgsedientlakmddgqldglafgaiqldgdgnilqynaaegditgrdpkqvigk
nffkdvapgtdspefygkfkegvasgnlntmfewmiptsrgptkvkvhmkkalsgdsywv
fvkrvklaaalehhhhhh