PDB entry 7aty

View 7aty on RCSB PDB site
Description: solution nmr structure of the sh3 domain of human caskin1
Deposited on 2020-11-01, released 2021-02-03
The last revision was dated 2021-02-03, with a file datestamp of 2021-01-29.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Caskin-1
    Species: Homo sapiens [TaxId:9606]
    Gene: CASKIN1, KIAA1306
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WXD9 (4-66)
      • expression tag (0-3)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >7atyA (A:)
gshmlqvratkdycnnydltslnvkagdiitvleqhpdgrwkgcihdnrtgndrvgyfps
slgeaiv