PDB entry 7atj

View 7atj on RCSB PDB site
Description: recombinant horseradish peroxidase c1a complex with cyanide and ferulic acid
Deposited on 1999-04-26, released 2000-01-14
The last revision prior to the SCOP 1.59 freeze date was dated 2000-01-14, with a file datestamp of 2000-01-13.
Experiment type: XRAY
Resolution: 1.47 Å
R-factor: 0.16
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d7atja_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >7atjA (A:)
    qltptfydnscpnvsnivrdtivnelrsdpriaasilrlhfhdcfvngcdasilldntts
    frtekdafgnansargfpvidrmkaavesacprtvscadlltiaaqqsvtlaggpswrvp
    lgrrdslqafldlananlpapfftlpqlkdsfrnvglnrssdlvalsgghtfgknqcrfi
    mdrlynfsntglpdptlnttylqtlrglcplngnlsalvdfdlrtptifdnkyyvnleeq
    kgliqsdqelfsspnatdtiplvrsfanstqtffnafveamdrmgnitpltgtqgqirln
    crvvn