PDB entry 7at1

View 7at1 on RCSB PDB site
Description: crystal structures of aspartate carbamoyltransferase ligated with phosphonoacetamide, malonate, and ctp or ATP at 2.8-angstroms resolution and neutral p*h
Class: transferase (carbamoyl-p,aspartate)
Keywords: transferase (carbamoyl-p,aspartate)
Deposited on 1989-09-22, released 1990-10-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.183
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aspartate carbamoyltransferase (r state), catalytic chain
    Species: Escherichia coli [TaxId:562]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A786 (0-309)
      • conflict (59)
      • conflict (146)
      • conflict (148)
      • conflict (195)
    Domains in SCOPe 2.06: d7at1a1, d7at1a2
  • Chain 'B':
    Compound: Aspartate carbamoyltransferase regulatory chain
    Species: Escherichia coli [TaxId:562]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A7F3 (Start-152)
      • conflict (7)
    Domains in SCOPe 2.06: d7at1b1, d7at1b2
  • Chain 'C':
    Compound: aspartate carbamoyltransferase (r state), catalytic chain
    Species: Escherichia coli [TaxId:562]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A786 (0-309)
      • conflict (59)
      • conflict (146)
      • conflict (148)
      • conflict (195)
    Domains in SCOPe 2.06: d7at1c1, d7at1c2
  • Chain 'D':
    Compound: Aspartate carbamoyltransferase regulatory chain
    Species: Escherichia coli [TaxId:562]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A7F3 (Start-152)
      • conflict (7)
    Domains in SCOPe 2.06: d7at1d1, d7at1d2
  • Heterogens: MAL, ZN, PCT, ATP

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >7at1A (A:)
    anplyqkhiisindlsrddlnlvlataaklkanpqpellkhkviascffeastrtrlsfq
    tsmhrlgasvvgfsdsantslgkkgetladtisvistyvdaivmrhpqegaarlatefsg
    nvpvlnagdgsnqhptqtlldlftiqqtegrldnlhvamvgdlkygrtvhsltqalakfd
    gnrfyfiapdalampeyildmldekgiawslhssieevmaevdilymtrvqkerldpsey
    anvkaqfvlrasdlhnakanmkvlhplprvdeiatdvdktphawyfqqagngifarqall
    alvlnrdlvl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >7at1B (B:)
    mthdnklgveaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlik
    ientflsedqvdqlalyapqatvnridnyevvgksrpslperidnvlvcpnsncishaep
    vsssfavrkrandialkckycekefshnvvlan
    

    Sequence, based on observed residues (ATOM records): (download)
    >7at1B (B:)
    gveaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlikientfls
    edqvdqlalyapqatvnridnyevvgksrpslperidnvlvcpnsncishaepvsssfav
    rkrandialkckycekefshnvvlan
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >7at1C (C:)
    anplyqkhiisindlsrddlnlvlataaklkanpqpellkhkviascffeastrtrlsfq
    tsmhrlgasvvgfsdsantslgkkgetladtisvistyvdaivmrhpqegaarlatefsg
    nvpvlnagdgsnqhptqtlldlftiqqtegrldnlhvamvgdlkygrtvhsltqalakfd
    gnrfyfiapdalampeyildmldekgiawslhssieevmaevdilymtrvqkerldpsey
    anvkaqfvlrasdlhnakanmkvlhplprvdeiatdvdktphawyfqqagngifarqall
    alvlnrdlvl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >7at1D (D:)
    mthdnklgveaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlik
    ientflsedqvdqlalyapqatvnridnyevvgksrpslperidnvlvcpnsncishaep
    vsssfavrkrandialkckycekefshnvvlan
    

    Sequence, based on observed residues (ATOM records): (download)
    >7at1D (D:)
    gveaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlikientfls
    edqvdqlalyapqatvnridnyevvgksrpslperidnvlvcpnsncishaepvsssfav
    rkrandialkckycekefshnvvlan