PDB entry 7asx

View 7asx on RCSB PDB site
Description: Fixed-target serial femtosecond crystallography using in cellulo grown Neurospora crassa HEX-1 microcrystals. (Chip 1)
Class: structural protein
Keywords: in cellulo crystals, Woronin body, septal pore sealing, STRUCTURAL PROTEIN
Deposited on 2020-10-28, released 2021-06-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-07-28, with a file datestamp of 2021-07-23.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: eIF-5a domain-containing protein
    Species: Neurospora crassa [TaxId:5141]
    Gene: GE21DRAFT_1527
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0B0EDT5 (0-175)
      • cloning artifact (176)
    Domains in SCOPe 2.08: d7asxa1, d7asxa2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >7asxA (A:)
mgyydddahghveadaaprattgtgtgsasqtvtipchhirlgdililqgrpcqvirist
saatgqhrylgvdlftkqlheessfvsnpapsvvvqtmlgpvfkqyrvldmqdgsivamt
etgdvkqnlpvidqsslwnrlqkafesgrgsvrvlvvsdhgremavdmkvvhgsrla

    Sequence, based on observed residues (ATOM records): (download) 
    >7asxA (A:)
qtvtipchhirlgdililqgrpcqviristsaatgqhrylgvdlftkqlheessfvsnpa
psvvvqtmlgpvfkqyrvldmqdgsivamtetgdvkqnlpvidqsslwnrlqkafesgrg
svrvlvvsdhgremavdmkvv