PDB entry 7asw

View 7asw on RCSB PDB site
Description: crystal structure of chloroplastic thioredoxin z defines a novel type- specific target recognition
Deposited on 2020-10-28, released 2021-05-19
The last revision was dated 2021-09-15, with a file datestamp of 2021-09-10.
Experiment type: XRAY
Resolution: 2.44 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thioredoxin-related protein CITRX
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Gene: CITRX, CHLRE_02g142800v5, CHLREDRAFT_195890
    Database cross-references and differences (RAF-indexed):
    • Uniprot A8J0Q8 (21-148)
      • initiating methionine (0)
      • expression tag (1-20)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >7aswA (A:)
mgsshhhhhhssglvprgshmvishgkvekisgeqlevaiasrdttlivdffatwcgpcl
llareleqvaeemdgrvkvvkidvdenpdlsnmlriqglptiviipkdagkpalrtegfl
paaqimeivgqieagqtpgqpqqpeapqq

    Sequence, based on observed residues (ATOM records):
    >7aswA (A:)
hmvikvekisgeqlevaiasrdttlivdffatwcgpclllareleqvaeemdgrvkvvki
dvdenpdlsnmlriqglptiviipkdagkpalrtegflpaaqimeivgqieag