PDB entry 7asi

View 7asi on RCSB PDB site
Description: Fixed-target serial femtosecond crystallography using in cellulo grown Neurospora crassa HEX-1 microcrystals. (Chips 1+2)
Class: structural protein
Keywords: in cellulo crystals, Woronin body, septal pore sealing, STRUCTURAL PROTEIN
Deposited on 2020-10-27, released 2021-06-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-07-28, with a file datestamp of 2021-07-23.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: eIF-5a domain-containing protein
    Species: Neurospora crassa [TaxId:5141]
    Gene: GE21DRAFT_1527
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0B0EDT5 (0-175)
      • cloning artifact (176)
    Domains in SCOPe 2.08: d7asia1, d7asia2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >7asiA (A:)
    mgyydddahghveadaaprattgtgtgsasqtvtipchhirlgdililqgrpcqvirist
    saatgqhrylgvdlftkqlheessfvsnpapsvvvqtmlgpvfkqyrvldmqdgsivamt
    etgdvkqnlpvidqsslwnrlqkafesgrgsvrvlvvsdhgremavdmkvvhgsrla
    

    Sequence, based on observed residues (ATOM records): (download)
    >7asiA (A:)
    qtvtipchhirlgdililqgrpcqviristsaatgqhrylgvdlftkqlheessfvsnpa
    psvvvqtmlgpvfkqyrvldmqdgsivamtetgdvkqnlpvidqsslwnrlqkafesgrg
    svrvlvvsdhgremavdmkvv