PDB entry 7apq

View 7apq on RCSB PDB site
Description: The Fk1 domain of FKBP51 in complex with (1S,5S,6R)-10-(benzo[d]thiazol-6-ylsulfonyl)-5-(methoxymethyl)-3-(pyridin-2-ylmethyl)-3,10-diazabicyclo[4.3.1]decan-2-one
Class: isomerase
Keywords: conformation analysis, density functional calculations, FKBPs, magic methyl, ISOMERASE
Deposited on 2020-10-19, released 2021-11-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-12-08, with a file datestamp of 2021-12-03.
Experiment type: XRAY
Resolution: 1.09 Å
R-factor: N/A
AEROSPACI score: 0.82 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptidyl-prolyl cis-trans isomerase FKBP5
    Species: Homo sapiens [TaxId:9606]
    Gene: FKBP5, AIG6, FKBP51
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13451 (3-127)
      • expression tag (0-2)
      • engineered mutation (6)
    Domains in SCOPe 2.08: d7apqa1, d7apqa2
  • Heterogens: RQW, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >7apqA (A:)
gapatvteqgeditskkdrgvlkivkrvgngeetpmigdkvyvhykgklsngkkfdsshd
rnepfvfslgkgqvikawdigvatmkkgeichllckpeyaygsagslpkipsnatlffei
elldfkge