PDB entry 7anq

View 7anq on RCSB PDB site
Description: Complete PCSK9 C-ter domain in complex with VHH P1.40
Class: hydrolase
Keywords: PCSK9, VHH P1.40, complex, HYDROLASE
Deposited on 2020-10-12, released 2021-10-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-10-20, with a file datestamp of 2021-10-15.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proprotein convertase subtilisin/kexin type 9
    Species: Homo sapiens [TaxId:9606]
    Gene: PCSK9, NARC1, PSEC0052
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: VHH P1.40 minibody anti-Cter PCSK9
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 7ANQ (0-126)
    Domains in SCOPe 2.08: d7anqb_
  • Heterogens: FUC, NAG, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >7anqB (B:)
    qvkleesggglvqaggslrlscspsdrtfsayamgwfrqvpgrerefvatirdsdasiyy
    tdsvkgrftisrdnakntvylqmnslipddtavyycaarqyysgrvystfreeydywgqg
    tqvtvss