PDB entry 7aj6

View 7aj6 on RCSB PDB site
Description: LN02 Fab
Class: immune system
Keywords: HIV, Fab, broadly neutralizing antibody, bNab, IMMUNE SYSTEM
Deposited on 2020-09-28, released 2021-10-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-10-06, with a file datestamp of 2021-10-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: LN02 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 7AJ6 (0-222)
  • Chain 'L':
    Compound: ln02
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 7AJ6 (0-208)
    Domains in SCOPe 2.08: d7aj6l_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >7aj6L (L:)
yvlgqsssmsvapgqtakiscwgyymgtkpvnwyqlkpgrapsliisydderasgtparf
sgshsgstatltisnvvpadeadyfcqvwdskyeeiyfgggtaltvlgqpkaapsvtlfp
psseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassyls
ltpeqwkshrsyscqvthegstvektvap