PDB entry 7aez

View 7aez on RCSB PDB site
Description: Crystal structure of the metallo-beta-lactamase NDM-7 with 407
Class: hydrolase
Keywords: hydrolase metallo-beta-lactamase antibiotic resistance, hydrolase
Deposited on 2020-09-18, released 2021-10-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-10-06, with a file datestamp of 2021-10-01.
Experiment type: XRAY
Resolution: 1.02 Å
R-factor: N/A
AEROSPACI score: 0.88 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Metallo-beta-lactamase NDM-7
    Species: Klebsiella pneumoniae [TaxId:573]
    Gene: blaNDM-7
    Database cross-references and differences (RAF-indexed):
    • Uniprot X5CZV5 (2-230)
      • expression tag (0-1)
    Domains in SCOPe 2.08: d7aeza1, d7aeza2
  • Heterogens: R8W, ZN, GOL, EDO, NA, ETX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >7aezA (A:)
etgdqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvlvvdtawtddqta
qilnwikqeinlpvalavvthahqdkmggmnalhaagiatyanalsnqlapqeglvaaqh
sltfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggclikdskakslg
nlgdadtehyaasarafgaafpkasmivmshsapdsraaithtarmadklr