PDB entry 7adh

View 7adh on RCSB PDB site
Description:
Deposited on 1984-01-16, released 1984-07-18
The last revision prior to the SCOP 1.55 freeze date was dated 1992-07-15, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 3.2 Å
R-factor: 0.29
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d7adh_1, d7adh_2

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >7adh_ (-)
    stagxvixcxaavlweexxpfsieevevappxahevrixmvatgicrsddhvvsgtlvtp
    lpviagheaagivesigegvttvrpgdxviplftpqcgxcrvckhpegnfclxndlsmpr
    gtmqdgtsrftcrgxpihhflgtstfsqytvvdeisvaxidaasplexvcligcgfstgy
    gsavxvaxvtqgstcavfglggvglsvimgcxaagaariigvdinxdxfaxakevgatec
    vnpqdyxkpiqevltemsnggvdfsfevigrldtmvtalsccqeaygvsvivgvppdsqn
    lsmnpmlllsgrtwkgaifggfksxdsvpxlvadfmakkfaldplithvlpfexinegfd
    llrsgesirtiltf
    

    Sequence, based on observed residues (ATOM records): (download)
    >7adh_ (-)
    stagvicaavlweepfsieevevappahevrimvatgicrsddhvvsgtlvtplpviagh
    eaagivesigegvttvrpgdviplftpqcgcrvckhpegnfclndlsmprgtmqdgtsrf
    tcrgpihhflgtstfsqytvvdeisvaidaasplevcligcgfstgygsavvavtqgstc
    avfglggvglsvimgcaagaariigvdindfaakevgatecvnpqdykpiqevltemsng
    gvdfsfevigrldtmvtalsccqeaygvsvivgvppdsqnlsmnpmlllsgrtwkgaifg
    gfksdsvplvadfmakkfaldplithvlpfeinegfdllrsgesirtiltf