PDB entry 7acu

View 7acu on RCSB PDB site
Description: Crystal structure of human transthyretin in complex with Benzbromarone
Class: transport protein
Keywords: transthyretin, TTR, benzbromarone, complex, TRANSPORT PROTEIN
Deposited on 2020-09-11, released 2020-10-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-10-28, with a file datestamp of 2020-10-23.
Experiment type: XRAY
Resolution: 1.54 Å
R-factor: N/A
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Gene: TTR, PALB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d7acua_
  • Chain 'B':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Gene: TTR, PALB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d7acub_
  • Heterogens: R75, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >7acuA (A:)
cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtn

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >7acuB (B:)
cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtn