PDB entry 7acs

View 7acs on RCSB PDB site
Description: the sars-cov-2 nucleocapsid phosphoprotein n-terminal domain in complex with 7mer dsrna
Deposited on 2020-09-11, released 2020-11-04
The last revision was dated 2020-12-30, with a file datestamp of 2020-12-25.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: nucleoprotein
  Species: Severe acute respiratory syndrome coronavirus 2 [TaxId:2697049]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0DTC9 (3-139)
    • expression tag (0-2)
• Chain 'B':
  Compound: RNA (5'-r(p*cp*ap*cp*up*gp*ap*c)-3')
  Species: Severe acute respiratory syndrome coronavirus 2, synthetic [TaxId:2697049]
  
• Chain 'C':
  Compound: RNA (5'-r(p*gp*up*cp*ap*gp*up*g)-3')
  Species: Severe acute respiratory syndrome coronavirus 2, synthetic [TaxId:2697049]
  

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records:
  

  >7acsA (A:)
  gamglpnntaswftaltqhgkedlkfprgqgvpintnsspddqigyyrratrrirggdgk
  mkdlsprwyfyylgtgpeaglpygankdgiiwvategalntpkdhigtrnpannaaivlq
  lpqgttlpkgfyaegsrggs
  

  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  No sequence available.