PDB entry 7acn

View 7acn on RCSB PDB site
Description: crystal structures of aconitase with isocitrate and nitroisocitrate bound
Class: lyase(carbon-oxygen)
Keywords: lyase(carbon-oxygen)
Deposited on 1991-05-15, released 1993-10-31
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-03-24, with a file datestamp of 2009-03-20.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.179
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aconitase
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16276 (1-753)
      • conflict (646)
    Domains in SCOPe 2.04: d7acna1, d7acna2
  • Heterogens: SF4, ICT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >7acnA (A:)
    erakvamshfepheyirydlleknidivrkrlnrpltlsekivyghlddpanqeiergkt
    ylrlrpdrvamqdataqmamlqfissglpkvavpstihcdhlieaqlggekdlrrakdin
    qevynflatagakygvgfwrpgsgiihqiilenyaypgvlligtdshtpnggglggicig
    vggadavdvmagipwelkcpkvigvkltgslsgwtspkdvilkvagiltvkggtgaivey
    hgpgvdsisctgmaticnmgaeigattsvfpynhrmkkylsktgradianladefkdhlv
    pdpgchydqvieinlselkphingpftpdlahpvaevgsvaekegwpldirvgligsctn
    ssyedmgrsaavakqalahglkcksqftitpgseqiratierdgyaqvlrdvggivlana
    cgpcigqwdrkdikkgekntivtsynrnftgrndanpethafvtspeivtalaiagtlkf
    npetdfltgkdgkkfkleapdadelpraefdpgqdtyqhppkdssgqrvdvsptsqrlql
    lepfdkwdgkdledlqilikvkgkcttdhisaagpwlkfrghldnisnnlligainienr
    kansvrnavtqefgpvpdtaryykqhgirwvvigdenygegssrehsaleprhlggraii
    tksfarihetnlkkqgllpltfadpadynkihpvdkltiqglkdfapgkplkciikhpng
    tqetillnhtfnetqiewfragsalnrmkelqqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >7acnA (A:)
    rakvamshfepheyirydlleknidivrkrlnrpltlsekivyghlddpanqeiergkty
    lrlrpdrvamqdataqmamlqfissglpkvavpstihcdhlieaqlggekdlrrakdinq
    evynflatagakygvgfwrpgsgiihqiilenyaypgvlligtdshtpnggglggicigv
    ggadavdvmagipwelkcpkvigvkltgslsgwtspkdvilkvagiltvkggtgaiveyh
    gpgvdsisctgmaticnmgaeigattsvfpynhrmkkylsktgradianladefkdhlvp
    dpgchydqvieinlselkphingpftpdlahpvaevgsvaekegwpldirvgligsctns
    syedmgrsaavakqalahglkcksqftitpgseqiratierdgyaqvlrdvggivlanac
    gpcigqwdrkdikkgekntivtsynrnftgrndanpethafvtspeivtalaiagtlkfn
    petdfltgkdgkkfkleapdadelpraefdpgqdtyqhppkdssgqrvdvsptsqrlqll
    epfdkwdgkdledlqilikvkgkcttdhisaagpwlkfrghldnisnnlligainienrk
    ansvrnavtqefgpvpdtaryykqhgirwvvigdenygegssrehsaleprhlggraiit
    ksfarihetnlkkqgllpltfadpadynkihpvdkltiqglkdfapgkplkciikhpngt
    qetillnhtfnetqiewfragsalnrmkelqqk