PDB entry 7abm

View 7abm on RCSB PDB site
Description: X-ray structure of phosphorylated Barrier-to-autointegration factor (BAF)
Class: DNA binding protein
Keywords: Barrier-to-Autointegration Factor chromosome compaction Phosphorylation, DNA BINDING PROTEIN
Deposited on 2020-09-08, released 2021-07-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-07-07, with a file datestamp of 2021-07-02.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: barrier-to-autointegration factor
    Species: Homo sapiens [TaxId:9606]
    Gene: BANF1, BAF, BCRG1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O75531 (0-85)
      • conflict (64)
      • conflict (74)
      • conflict (77)
      • conflict (82)
    Domains in SCOPe 2.08: d7abma_
  • Heterogens: SEP, CS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >7abmA (A:)
tsqkhrdfvaepmgekpvgslagigevlgkkleergfdkayvvlgqflvlkkdedlfrew
lkdtaganakqsrdafgalrewadaf