PDB entry 7aa8

View 7aa8 on RCSB PDB site
Description: Structure of SCOC LIR bound to GABARAP
Class: signaling protein
Keywords: scoc, atg8, lir, signaling protein
Deposited on 2020-09-03, released 2021-06-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-06-16, with a file datestamp of 2021-06-11.
Experiment type: XRAY
Resolution: 1.25 Å
R-factor: N/A
AEROSPACI score: 0.71 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'C':
    Compound: Chimera made of SCOC (6-23) + linker (GS) + GABARAP,Gamma-aminobutyric acid receptor-associated protein
    Species: Homo sapiens [TaxId:9606]
    Gene: GABARAP, FLC3B, HT004
    Database cross-references and differences (RAF-indexed):
    • PDB 7AA8 (Start-24)
    • Uniprot O95166 (25-End)
    Domains in SCOPe 2.08: d7aa8c1, d7aa8c2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'C':
    Sequence, based on SEQRES records: (download) 
    >7aa8C (C:)
gptmgkeeeedstftnisladdigsmkfvykeehpfekrrsegekirkkypdrvpvivek
apkarigdldkkkylvpsdltvgqfyflirkrihlraedalfffvnnvipptsatmgqly
qehheedfflyiaysdesvygl

    Sequence, based on observed residues (ATOM records): (download) 
    >7aa8C (C:)
gkeeeedstftnisladdigsmkfvykeehpfekrrsegekirkkypdrvpvivekapka
rigdldkkkylvpsdltvgqfyflirkrihlraedalfffvnnvipptsatmgqlyqehh
eedfflyiaysde