PDB entry 7a5w

View 7a5w on RCSB PDB site
Description: structure of d172n blac from mycobacterium tuberculosis
Deposited on 2020-08-24, released 2021-07-07
The last revision was dated 2021-07-28, with a file datestamp of 2021-07-23.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-lactamase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: blaC, ERS027646_02769
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A655AHQ9 (1-265)
      • expression tag (0)
      • engineered mutation (146)
  • Heterogens: EDO, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >7a5wA (A:)
gdladrfaelerrydarlgvyvpatgttaaieyraderfafcstfkaplvaavlhqnplt
hldklitytsddirsispvaqqhvqtgmtigqlcdaairysdgtaanllladlggpgggt
aaftgylrslgdtvsrldaeepelnrnppgderdtttphaialvlqqlvlgnalppdkra
lltdwmarnttgakriragfpadwkvidktgtgdygrandiavvwsptgvpyvvavmsdr
agggydaepreallaeaatcvagvla