PDB entry 7a3m

View 7a3m on RCSB PDB site
Description: Synergistic stabilization of a double mutant in CI2 from an in-cell library screen
Class: protein binding
Keywords: Chymotrypsin inhibitor CI-2, mutant, PROTEIN BINDING
Deposited on 2020-08-18, released 2020-12-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-12-09, with a file datestamp of 2020-12-04.
Experiment type: XRAY
Resolution: 1.01 Å
R-factor: N/A
AEROSPACI score: 0.9 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: subtilisin-chymotrypsin inhibitor-2a
    Species: Hordeum vulgare [TaxId:4513]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01053 (1-63)
      • initiating methionine (0)
      • conflict (56)
    Domains in SCOPe 2.08: d7a3ma_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >7a3mA (A:)
    mktewpelvgksveeakkvilqdkpeaqiivlpvgtivtmeyridrvrlfvdkldnvaqv
    prvg