PDB entry 7a3h

View 7a3h on RCSB PDB site
Description:
Deposited on 1998-08-05, released 1999-08-06
The last revision prior to the SCOP 1.61 freeze date was dated 1999-08-06, with a file datestamp of 1999-08-05.
Experiment type: XRAY
Resolution: 0.95 Å
R-factor: 0.11
AEROSPACI score: 1.09 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.61: d7a3ha_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >7a3hA (A:)
    svveehgqlsisngelvnergeqvqlkgmsshglqwygqfvnyesmkwlrddwginvfra
    amytssggyiddpsvkekvkeaveaaidldiyviidwhilsdndpniykeeakdffdems
    elygdypnviyeianepngsdvtwgnqikpyaeevipiirnndpnniiivgtgtwsqdvh
    haadnqladpnvmyafhfyagthgqnlrdqvdyaldqgaaifvsewgtsaatgdggvfld
    eaqvwidfmdernlswanwslthkdessaalmpganptggwteaelspsgtfvrekires