PDB entry 7a38

View 7a38 on RCSB PDB site
Description: Crystal structure of the c-Src SH3 domain mutant V111L-N113S-T114S-Q128E at pH 6.0
Class: protein binding
Keywords: beta barrel, SH3 domain, PROTEIN BINDING
Deposited on 2020-08-18, released 2021-08-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-08-25, with a file datestamp of 2021-08-20.
Experiment type: XRAY
Resolution: 1.62 Å
R-factor: N/A
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Proto-oncogene tyrosine-protein kinase Src
  Species: Gallus gallus [TaxId:9031]
  Gene: SRC
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00523 (0-59)
    • engineered mutation (29)
    • engineered mutation (31-32)
    • engineered mutation (46)
  Domains in SCOPe 2.08: d7a38a_
• Chain 'B':
  Compound: Proto-oncogene tyrosine-protein kinase Src
  Species: Gallus gallus [TaxId:9031]
  Gene: SRC
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00523 (0-59)
    • engineered mutation (29)
    • engineered mutation (31-32)
    • engineered mutation (46)
  Domains in SCOPe 2.08: d7a38b_
• Heterogens: MES, SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >7a38A (A:)
  gvttfvalydyesrtetdlsfkkgerlqilnssegdwwlahslttgetgyipsnyvapsd
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >7a38A (A:)
  vttfvalydyesrtetdlsfkkgerlqilnssegdwwlahslttgetgyipsnyvapsd
  

  
  
• Chain 'B':
  Sequence, based on SEQRES records: (download)
  

  >7a38B (B:)
  gvttfvalydyesrtetdlsfkkgerlqilnssegdwwlahslttgetgyipsnyvapsd
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >7a38B (B:)
  gvttfvalydyesrtetdlsfkkgerlqilngdwwlahslttgetgyipsnyvapsd