PDB entry 7a35

View 7a35 on RCSB PDB site
Description: Crystal structure of the c-Src SH3 domain mutant V111L-N113S-T114S at pH 7.0
Class: protein binding
Keywords: beta barrel, SH3 domain, PROTEIN BINDING
Deposited on 2020-08-18, released 2021-08-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-08-25, with a file datestamp of 2021-08-20.
Experiment type: XRAY
Resolution: 1.31 Å
R-factor: N/A
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proto-oncogene tyrosine-protein kinase Src
    Species: Gallus gallus [TaxId:9031]
    Gene: SRC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00523 (0-59)
      • engineered mutation (29)
      • engineered mutation (31-32)
    Domains in SCOPe 2.08: d7a35a_
  • Chain 'B':
    Compound: Proto-oncogene tyrosine-protein kinase Src
    Species: Gallus gallus [TaxId:9031]
    Gene: SRC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00523 (0-59)
      • engineered mutation (29)
      • engineered mutation (31-32)
    Domains in SCOPe 2.08: d7a35b_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >7a35A (A:)
    gvttfvalydyesrtetdlsfkkgerlqilnssegdwwlahslttgqtgyipsnyvapsd
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >7a35B (B:)
    gvttfvalydyesrtetdlsfkkgerlqilnssegdwwlahslttgqtgyipsnyvapsd