PDB entry 7a30

View 7a30 on RCSB PDB site
Description: Intertwined dimer of the c-Src SH3 domain mutant Q128E
Class: protein binding
Keywords: beta barrel, SH3 domain, PROTEIN BINDING
Deposited on 2020-08-18, released 2021-08-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-08-25, with a file datestamp of 2021-08-20.
Experiment type: XRAY
Resolution: 1.67 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proto-oncogene tyrosine-protein kinase Src
    Species: Gallus gallus [TaxId:9031]
    Gene: SRC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00523 (0-59)
      • engineered mutation (46)
    Domains in SCOPe 2.08: d7a30a_
  • Heterogens: PGE, PEG, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >7a30A (A:)
    gvttfvalydyesrtetdlsfkkgerlqivnntegdwwlahslttgetgyipsnyvapsd
    

    Sequence, based on observed residues (ATOM records): (download)
    >7a30A (A:)
    ttfvalydyesrtetdlsfkkgerlqivnntegdwwlahslttgetgyipsnyvaps