PDB entry 7a1g

View 7a1g on RCSB PDB site
Description: Structure of a crosslinked yeast ABCE1-bound 43S pre-initiation complex
Class: ribosome
Keywords: Translation, Initiation, Ribosome Recycling, ABC Proteins, RIBOSOME
Deposited on 2020-08-13, released 2020-10-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-01-13, with a file datestamp of 2021-01-08.
Experiment type: EM
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

• Chain '2':
  Compound: 18S Ribosomal RNA
  Species: SACCHAROMYCES CEREVISIAE S288C [TaxId:559292]
  
• Chain 'A':
  Compound: 40S ribosomal protein S3
  Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P05750 (0-221)
• Chain 'B':
  Compound: 40S ribosomal protein S5
  Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P26783 (0-205)
• Chain 'C':
  Compound: 40S ribosomal protein S10-A
  Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q08745 (0-91)
• Chain 'D':
  Compound: 40s ribosomal protein s12
  Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P48589 (0-120)
• Chain 'E':
  Compound: 40S ribosomal protein S15
  Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q01855 (0-116)
• Chain 'F':
  Compound: 40S ribosomal protein S16-A
  Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0CX51 (0-140)
• Chain 'H':
  Compound: 40S ribosomal protein S17-B
  Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P14127 (0-124)
• Chain 'I':
  Compound: 40S ribosomal protein S18-A
  Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0CX55 (0-144)
• Chain 'J':
  Compound: 40S ribosomal protein S19-A
  Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P07280 (0-142)
• Chain 'K':
  Compound: 40S ribosomal protein S20
  Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P38701 (0-99)
• Chain 'L':
  Compound: 40S ribosomal protein S25-A
  Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q3E792 (0-81)
• Chain 'M':
  Compound: 40S ribosomal protein S29-A
  Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P41057 (0-52)
• Chain 'N':
  Compound: Ubiquitin-40S ribosomal protein S31
  Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P05759 (0-72)
• Chain 'O':
  Compound: Guanine nucleotide-binding protein subunit beta-like protein
  Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P38011 (0-311)
  Domains in SCOPe 2.08: d7a1go_
• Chain 'P':
  Compound: 40S ribosomal protein S0-A
  Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P32905 (0-205)
• Chain 'Q':
  Compound: 40S ribosomal protein S1-A
  Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P33442 (0-231)
• Chain 'R':
  Compound: 40S ribosomal protein S2
  Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P25443 (0-215)
• Chain 'S':
  Compound: 40S ribosomal protein S4-A
  Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0CX35 (0-257)
• Chain 'T':
  Compound: 40S ribosomal protein S6-A
  Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0CX37 (0-227)
• Chain 'U':
  Compound: 40S ribosomal protein S7-A
  Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P26786 (0-183)
• Chain 'V':
  Compound: 40S ribosomal protein S8-A
  Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0CX39
• Chain 'W':
  Compound: 40S ribosomal protein S9-A
  Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
  Database cross-references and differences (RAF-indexed):
  • Uniprot O13516 (0-183)
• Chain 'X':
  Compound: 40S ribosomal protein S11-A
  Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0CX47 (0-141)
• Chain 'Y':
  Compound: 40S ribosomal protein S13
  Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P05756 (0-149)
• Chain 'Z':
  Compound: 40S ribosomal protein S14-B
  Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P39516 (0-126)
• Chain 'a':
  Compound: 40S ribosomal protein S21-A
  Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0C0V8 (0-86)
• Chain 'b':
  Compound: 40S ribosomal protein S22-A
  Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0C0W1 (0-128)
• Chain 'c':
  Compound: 40S ribosomal protein S23-A
  Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0CX29 (0-143)
• Chain 'd':
  Compound: 40S ribosomal protein S24-A
  Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0CX31 (0-133)
• Chain 'e':
  Compound: 40s ribosomal protein s26-b
  Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P39939 (0-96)
• Chain 'f':
  Compound: 40S ribosomal protein S27-A
  Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P35997 (0-80)
• Chain 'g':
  Compound: 40S ribosomal protein S30-A
  Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0CX33 (0-59)
• Chain 'h':
  Compound: 40S ribosomal protein S28-A
  Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q3E7X9 (0-62)
• Chain 'x':
  Compound: translation initiation factor rli1
  Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q03195 (0-600)
• Chain 'y':
  Compound: Eukaryotic translation initiation factor 3 subunit J
  Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q05775
• Chain 'z':
  Compound: Eukaryotic translation initiation factor 3 subunit J
  Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q05775
• Heterogens: MG, ZN, SF4, ADP

PDB Chain Sequences:

• Chain '2':
  No sequence available.
  
  
• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  No sequence available.
  
  
• Chain 'E':
  No sequence available.
  
  
• Chain 'F':
  No sequence available.
  
  
• Chain 'H':
  No sequence available.
  
  
• Chain 'I':
  No sequence available.
  
  
• Chain 'J':
  No sequence available.
  
  
• Chain 'K':
  No sequence available.
  
  
• Chain 'L':
  No sequence available.
  
  
• Chain 'M':
  No sequence available.
  
  
• Chain 'N':
  No sequence available.
  
  
• Chain 'O':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >7a1gO (O:)
  evlvlrgtleghngwvtslatsagqpnlllsasrdktliswkltgddqkfgvpvrsfkgh
  shivqdctltadgayalsaswdktlrlwdvatgetyqrfvghksdvmsvdidkkasmiis
  gsrdktikvwtikgqclatllghndwvsqvrvvpnekadddsvtiisagndkmvkawnln
  qfqieadfighnsnintltaspdgtliasagkdgeimlwnlaakkamytlsaqdevfsla
  fspnrywlaaatatgikvfsldpqylvddlrpefagyskaaephavslawsadgqtlfag
  ytdnvirvwqvm
  

  
  
• Chain 'P':
  No sequence available.
  
  
• Chain 'Q':
  No sequence available.
  
  
• Chain 'R':
  No sequence available.
  
  
• Chain 'S':
  No sequence available.
  
  
• Chain 'T':
  No sequence available.
  
  
• Chain 'U':
  No sequence available.
  
  
• Chain 'V':
  No sequence available.
  
  
• Chain 'W':
  No sequence available.
  
  
• Chain 'X':
  No sequence available.
  
  
• Chain 'Y':
  No sequence available.
  
  
• Chain 'Z':
  No sequence available.
  
  
• Chain 'a':
  No sequence available.
  
  
• Chain 'b':
  No sequence available.
  
  
• Chain 'c':
  No sequence available.
  
  
• Chain 'd':
  No sequence available.
  
  
• Chain 'e':
  No sequence available.
  
  
• Chain 'f':
  No sequence available.
  
  
• Chain 'g':
  No sequence available.
  
  
• Chain 'h':
  No sequence available.
  
  
• Chain 'x':
  No sequence available.
  
  
• Chain 'y':
  No sequence available.
  
  
• Chain 'z':
  No sequence available.