PDB entry 7a17

View 7a17 on RCSB PDB site
Description: Crystal structure of the 5-phosphatase domain of Synaptojanin1 bound to its substrate diC8-PI(3,4,5)P3 in complex with a nanobody
Class: hydrolase
Keywords: Inositol polyphosphate 5-phosphatase, Phosphoinositide, Enzyme-substrate complex, Catalytic Mechanism, Parkinson's disease, Epilepsy, HYDROLASE
Deposited on 2020-08-12, released 2020-12-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-01-06, with a file datestamp of 2021-01-01.
Experiment type: XRAY
Resolution: 2.73 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Isoform 2 of Synaptojanin-1
    Species: Homo sapiens [TaxId:9606]
    Gene: SYNJ1, KIAA0910
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Nanobody 13015
    Species: Lama glama [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 7A17 (0-118)
    Domains in SCOPe 2.08: d7a17b_
  • Chain 'C':
    Compound: Isoform 2 of Synaptojanin-1
    Species: Homo sapiens [TaxId:9606]
    Gene: SYNJ1, KIAA0910
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Nanobody 13015
    Species: Lama glama [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 7A17 (0-122)
    Domains in SCOPe 2.08: d7a17d_
  • Chain 'E':
    Compound: Isoform 2 of Synaptojanin-1
    Species: Homo sapiens [TaxId:9606]
    Gene: SYNJ1, KIAA0910
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Nanobody 13015
    Species: Lama glama [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 7A17 (0-124)
    Domains in SCOPe 2.08: d7a17f_
  • Heterogens: IP9, MG, GOL, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >7a17B (B:)
qvqlvesgggfaqaggslrlscaasgstfrframgwfrqapgkerefvagiswsgstkyt
dsvkgrftisrdnakntvhlqmnnltpedtavyycaqsraieaddsrgydywgqgtqvt

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >7a17D (D:)
qvqlvesgggfaqaggslrlscaasgstfrframgwfrqapgkerefvagiswsgstkyt
dsvkgrftisrdnakntvhlqmnnltpedtavyycaqsraieaddsrgydywgqgtqvtv
ssh

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >7a17F (F:)
qvqlvesgggfaqaggslrlscaasgstfrframgwfrqapgkerefvagiswsgstkyt
dsvkgrftisrdnakntvhlqmnnltpedtavyycaqsraieaddsrgydywgqgtqvtv
sshhh