PDB entry 7a05

View 7a05 on RCSB PDB site
Description: nmr structure of d3-d4 domains of vibrio vulnificus ribosomal protein s1
Deposited on 2020-08-06, released 2021-06-23
The last revision was dated 2021-07-28, with a file datestamp of 2021-07-23.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 30S ribosomal protein S1
    Species: Vibrio vulnificus [TaxId:672]
    Gene: rpsA, CRN34_17730, CRN52_15765, D8T49_21570, JS86_12670
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >7a05A (A:)
gametlqegsevkgivknltdygafvdlggvdgllhitdmawkrvkhpseivnvgdeilv
kvlkfdrdrtrvslglkqlgedpwvaiakrypeghklsgrvtnltdygcfveieegvegl
vhvsemdwtnknihpskvvnvgdevevmvleideerrrislglkqckanpwqs