PDB entry 7a00

View 7a00 on RCSB PDB site
Description: crystal structure of shank1 pdz in complex with l6f mutant of the c- terminal hexapeptide from gkap
Deposited on 2020-08-05, released 2021-07-07
The last revision was dated 2021-07-07, with a file datestamp of 2021-07-02.
Experiment type: XRAY
Resolution: 1.78 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: SH3 and multiple ankyrin repeat domains protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: shank1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y566 (3-111)
      • expression tag (0-2)
  • Chain 'B':
    Compound: SH3 and multiple ankyrin repeat domains protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: shank1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y566 (3-111)
      • expression tag (0-2)
  • Chain 'C':
    Compound: L6F mutant of C-terminal hexapeptide from Guanylate kinase-associated protein
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 7A00 (Start-5)
  • Chain 'D':
    Compound: L6F mutant of C-terminal hexapeptide from Guanylate kinase-associated protein
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 7A00 (Start-5)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >7a00A (A:)
gplgsdyiikektvllqkkdsegfgfvlrgakaqtpieeftptpafpalqylesvdeggv
awraglrmgdflievngqnvvkvghrqvvnmirqggntlmvkvvmvtrhpdm

    Sequence, based on observed residues (ATOM records):
    >7a00A (A:)
gplgsdyiikektvllqkkdsegfgfvlrgakqtpieeftptpafpalqylesvdeggva
wraglrmgdflievngqnvvkvghrqvvnmirqggntlmvkvvmvtrhpdm

  • Chain 'B':
    Sequence, based on SEQRES records:
    >7a00B (B:)
gplgsdyiikektvllqkkdsegfgfvlrgakaqtpieeftptpafpalqylesvdeggv
awraglrmgdflievngqnvvkvghrqvvnmirqggntlmvkvvmvtrhpdm

    Sequence, based on observed residues (ATOM records):
    >7a00B (B:)
gplgsdyiikektvllqkkdsegfgfvlrgakaqftptpafpalqylesvdeggvawrag
lrmgdflievngqnvvkvghrqvvnmirqggntlmvkvvmvtrhpdm

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records:
    >7a00C (C:)
eaqtrf

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records:
    >7a00D (D:)
eaqtrf