PDB entry 6zyh

View 6zyh on RCSB PDB site
Description: Crystal structure of GRP78 (70kDa heat shock protein 5 / BiP) ATPase domain in complex with ADP and calcium
Class: chaperone
Keywords: BiP, HSP70, GRP78, ATPase domain, NBD, ADP, CHAPERONE
Deposited on 2020-08-01, released 2020-12-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-12-16, with a file datestamp of 2020-12-11.
Experiment type: XRAY
Resolution: 1.88 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Endoplasmic reticulum chaperone BiP
    Species: Cricetulus griseus [TaxId:10029]
    Gene: HSPA5, GRP78, I79_019946
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6zyha1, d6zyha2
  • Chain 'B':
    Compound: Endoplasmic reticulum chaperone BiP
    Species: Cricetulus griseus [TaxId:10029]
    Gene: HSPA5, GRP78, I79_019946
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6zyhb1, d6zyhb2
  • Heterogens: ADP, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6zyhA (A:)
    gtvvgidlgttyscvgvfkngrveiiandqgnritpsyvaftpegerligdaaknqltsn
    pentvfdakrligrtwndpsvqqdikflpfkvvekktkpyiqvdigggqtktfapeeisa
    mvltkmketaeaylgkkvthavvtvpayfndaqrqatkdagtiaglnvmriineptaaai
    aygldkregeknilvfdlgggtfdvslltidngvfevvatngdthlggedfdqrvmehfi
    klykkktgkdvrkdnravqklrrevekakralssqhqarieiesffegedfsetltrakf
    eelnmdlfrstmkpvqkvledsdlkksdideivlvggstripkiqqlvkeffngkepsrg
    inpdeavaygaavqagvls
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6zyhB (B:)
    gtvvgidlgttyscvgvfkngrveiiandqgnritpsyvaftpegerligdaaknqltsn
    pentvfdakrligrtwndpsvqqdikflpfkvvekktkpyiqvdigggqtktfapeeisa
    mvltkmketaeaylgkkvthavvtvpayfndaqrqatkdagtiaglnvmriineptaaai
    aygldkregeknilvfdlgggtfdvslltidngvfevvatngdthlggedfdqrvmehfi
    klykkktgkdvrkdnravqklrrevekakralssqhqarieiesffegedfsetltrakf
    eelnmdlfrstmkpvqkvledsdlkksdideivlvggstripkiqqlvkeffngkepsrg
    inpdeavaygaavqagvls