PDB entry 6zsx

View 6zsx on RCSB PDB site
Description: M2 mutant (R111K:Y134F:T54V:R132Q:P39Y:R59Y) of human cellular retinoic acid binding protein II - 4 conjugate
Class: transport protein
Keywords: human cellular retinoic acid binding protein II, hCRABPII, conjigate, chromophore, M2, TRANSPORT PROTEIN
Deposited on 2020-07-16, released 2021-07-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-07-28, with a file datestamp of 2021-07-23.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cellular retinoic acid-binding protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: CRABP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29373 (3-140)
      • expression tag (0-2)
      • engineered mutation (42)
      • engineered mutation (57)
      • engineered mutation (62)
      • engineered mutation (114)
      • engineered mutation (135)
      • engineered mutation (137)
    Domains in SCOPe 2.08: d6zsxa1, d6zsxa2
  • Heterogens: QPE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >6zsxA (A:)
gshmpnfsgnwkiirsenfeellkvlgvnvmlrkiavaaaskyaveikqegdtfyikvst
tvytteinfkvgeefeeqtvdgrpckslvkwesenkmvceqkllkgegpktswtkeltnd
geliltmtaddvvctqvfvre

    Sequence, based on observed residues (ATOM records): (download) 
    >6zsxA (A:)
hmpnfsgnwkiirsenfeellkvlgvnvmlrkiavaaaskyaveikqegdtfyikvsttv
ytteinfkvgeefeeqtvdgrpckslvkwesenkmvceqkllkgegpktswtkeltndge
liltmtaddvvctqvfvre