PDB entry 6zoi

View 6zoi on RCSB PDB site
Description: A lid blocking mechanism of a cone snail toxin revealed at the atomic level
Class: toxin
Keywords: conkunitzin-3, TOXIN
Deposited on 2020-07-07, released 2021-07-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-07-14, with a file datestamp of 2021-07-09.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Conknunitzin-C3 mutante
  Species: Escherichia coli K-12 [TaxId:83333]
  Database cross-references and differences (RAF-indexed):
  • PDB 6ZOI (0-59)
  Domains in SCOPe 2.08: d6zoia_
• Chain 'B':
  Compound: Conknunitzin-C3 mutante
  Species: Escherichia coli K-12 [TaxId:83333]
  Database cross-references and differences (RAF-indexed):
  • PDB 6ZOI (0-59)
  Domains in SCOPe 2.08: d6zoib_
• Chain 'C':
  Compound: Conknunitzin-C3 mutante
  Species: Escherichia coli K-12 [TaxId:83333]
  Database cross-references and differences (RAF-indexed):
  • PDB 6ZOI (0-59)
  Domains in SCOPe 2.08: d6zoic_
• Chain 'D':
  Compound: Conknunitzin-C3 mutante
  Species: Escherichia coli K-12 [TaxId:83333]
  Database cross-references and differences (RAF-indexed):
  • PDB 6ZOI (0-59)
  Domains in SCOPe 2.08: d6zoid_
• Chain 'E':
  Compound: Conknunitzin-C3 mutante
  Species: Escherichia coli K-12 [TaxId:83333]
  Database cross-references and differences (RAF-indexed):
  • PDB 6ZOI (0-59)
  Domains in SCOPe 2.08: d6zoie_
• Chain 'F':
  Compound: Conknunitzin-C3 mutante
  Species: Escherichia coli K-12 [TaxId:83333]
  Database cross-references and differences (RAF-indexed):
  • PDB 6ZOI (0-59)
  Domains in SCOPe 2.08: d6zoif_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6zoiA (A:)
  drpsycnlpadsgsgtkseqriyynsarkqcltftyngkggnennfihtydcartcqypa
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6zoiB (B:)
  drpsycnlpadsgsgtkseqriyynsarkqcltftyngkggnennfihtydcartcqypa
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6zoiC (C:)
  drpsycnlpadsgsgtkseqriyynsarkqcltftyngkggnennfihtydcartcqypa
  

  
  
• Chain 'D':
  Sequence, based on SEQRES records: (download)
  

  >6zoiD (D:)
  drpsycnlpadsgsgtkseqriyynsarkqcltftyngkggnennfihtydcartcqypa
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >6zoiD (D:)
  rpsycnlpadsgsgtkseqriyynsarkqcltftyngkggnennfihtydcartcqypa
  

  
  
• Chain 'E':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6zoiE (E:)
  drpsycnlpadsgsgtkseqriyynsarkqcltftyngkggnennfihtydcartcqypa
  

  
  
• Chain 'F':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6zoiF (F:)
  drpsycnlpadsgsgtkseqriyynsarkqcltftyngkggnennfihtydcartcqypa