PDB entry 6zkn
View 6zkn on RCSB PDB site
Description: Complex I inhibited by rotenone, open3
Class: electron transport
Keywords: complex, respiration, NADH, proton pump, mitochondria, iron-sulphur cluster, oxidoreductase, membrane protein, ELECTRON TRANSPORT
Deposited on
2020-06-30, released
2020-10-07
The last revision prior to the SCOPe 2.08 freeze date was dated
2020-11-11, with a file datestamp of
2020-11-06.
Experiment type: EM
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.25
(click here for full SPACI score report)
Chains and heterogens:
- Chain '1':
Compound: nadh dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial
Species: Ovis aries [TaxId:9940]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d6zkn11, d6zkn12, d6zkn13 - Chain '2':
Compound: Mitochondrial complex I, 24 kDa subunit
Species: Ovis aries [TaxId:9940]
Database cross-references and differences (RAF-indexed):
- Chain '3':
Compound: NADH:ubiquinone oxidoreductase core subunit S1
Species: Ovis aries [TaxId:9940]
Database cross-references and differences (RAF-indexed):
- Chain '4':
Compound: Mitochondrial complex I, 49 kDa subunit
Species: Ovis aries [TaxId:9940]
Database cross-references and differences (RAF-indexed):
- Chain '5':
Compound: NADH:ubiquinone oxidoreductase core subunit S3
Species: Ovis aries [TaxId:9940]
Database cross-references and differences (RAF-indexed):
- Chain '6':
Compound: Mitochondrial complex I, PSST subunit
Species: Ovis aries [TaxId:9940]
Database cross-references and differences (RAF-indexed):
- Chain '9':
Compound: Mitochondrial complex I, TYKY subunit
Species: Ovis aries [TaxId:9940]
Database cross-references and differences (RAF-indexed):
- Chain 'A':
Compound: NADH-ubiquinone oxidoreductase chain 3
Species: Ovis aries [TaxId:9940]
Database cross-references and differences (RAF-indexed):
- Chain 'H':
Compound: NADH-ubiquinone oxidoreductase chain 1
Species: Ovis aries [TaxId:9940]
Database cross-references and differences (RAF-indexed):
- Chain 'J':
Compound: NADH-ubiquinone oxidoreductase chain 6
Species: Ovis aries [TaxId:9940]
Database cross-references and differences (RAF-indexed):
- Chain 'K':
Compound: NADH-ubiquinone oxidoreductase chain 4L
Species: Ovis aries [TaxId:9940]
Database cross-references and differences (RAF-indexed):
- Chain 'L':
Compound: NADH-ubiquinone oxidoreductase chain 5
Species: Ovis aries [TaxId:9940]
Database cross-references and differences (RAF-indexed):
- Chain 'M':
Compound: NADH-ubiquinone oxidoreductase chain 4
Species: Ovis aries [TaxId:9940]
Database cross-references and differences (RAF-indexed):
- Chain 'N':
Compound: NADH-ubiquinone oxidoreductase chain 2
Species: Ovis aries [TaxId:9940]
Database cross-references and differences (RAF-indexed):
- Chain 'V':
Compound: Mitochondrial complex I, B14.7 subunit
Species: Ovis aries [TaxId:9940]
Database cross-references and differences (RAF-indexed):
- Chain 'W':
Compound: NADH:ubiquinone oxidoreductase subunit B5
Species: Ovis aries [TaxId:9940]
Database cross-references and differences (RAF-indexed):
- Chain 'X':
Compound: Acyl carrier protein
Species: Ovis aries [TaxId:9940]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d6zknx_ - Chain 'Y':
Compound: nadh dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8
Species: Ovis aries [TaxId:9940]
Database cross-references and differences (RAF-indexed):
- Chain 'Z':
Compound: Mitochondrial complex I, PDSW subunit
Species: Ovis aries [TaxId:9940]
Database cross-references and differences (RAF-indexed):
- Chain 'a':
Compound: Mitochondrial complex I, 10 kDa subunit
Species: Ovis aries [TaxId:9940]
Database cross-references and differences (RAF-indexed):
- Chain 'b':
Compound: Mitochondrial complex I, 13 kDa subunit
Species: Ovis aries [TaxId:9940]
Database cross-references and differences (RAF-indexed):
- Chain 'c':
Compound: NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial
Species: Ovis aries [TaxId:9940]
Database cross-references and differences (RAF-indexed):
- Chain 'd':
Compound: NADH:ubiquinone oxidoreductase subunit A9
Species: Ovis aries [TaxId:9940]
Database cross-references and differences (RAF-indexed):
- Chain 'e':
Compound: nadh dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2
Species: Ovis aries [TaxId:9940]
Database cross-references and differences (RAF-indexed):
- Chain 'f':
Compound: Mitochondrial complex I, B13 subunit
Species: Ovis aries [TaxId:9940]
Database cross-references and differences (RAF-indexed):
- Chain 'g':
Compound: NADH:ubiquinone oxidoreductase subunit A6
Species: Ovis aries [TaxId:9940]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d6zkng_ - Chain 'h':
Compound: Mitochondrial complex I, B14.5a subunit
Species: Ovis aries [TaxId:9940]
Database cross-references and differences (RAF-indexed):
- Chain 'i':
Compound: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12
Species: Ovis aries [TaxId:9940]
Database cross-references and differences (RAF-indexed):
- Chain 'j':
Compound: Acyl carrier protein
Species: Ovis aries [TaxId:9940]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d6zknj_ - Chain 'k':
Compound: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial
Species: Ovis aries [TaxId:9940]
Database cross-references and differences (RAF-indexed):
- Chain 'l':
Compound: NADH:ubiquinone oxidoreductase subunit S5
Species: Ovis aries [TaxId:9940]
Database cross-references and differences (RAF-indexed):
- Chain 'm':
Compound: NADH:ubiquinone oxidoreductase subunit A3
Species: Ovis aries [TaxId:9940]
Database cross-references and differences (RAF-indexed):
- Chain 'n':
Compound: NADH:ubiquinone oxidoreductase subunit B3
Species: Ovis aries [TaxId:9940]
Database cross-references and differences (RAF-indexed):
- Chain 'o':
Compound: NADH dehydrogenase [ubiquinone] 1 subunit C2
Species: Ovis aries [TaxId:9940]
Database cross-references and differences (RAF-indexed):
- Chain 'p':
Compound: NADH:ubiquinone oxidoreductase subunit B4
Species: Ovis aries [TaxId:9940]
Database cross-references and differences (RAF-indexed):
- Chain 'q':
Compound: Mitochondrial complex I, B16.6 subunit
Species: Ovis aries [TaxId:9940]
Database cross-references and differences (RAF-indexed):
- Chain 'r':
Compound: Mitochondrial complex I, B17 subunit
Species: Ovis aries [TaxId:9940]
Database cross-references and differences (RAF-indexed):
- Chain 's':
Compound: NADH:ubiquinone oxidoreductase subunit B7
Species: Ovis aries [TaxId:9940]
Database cross-references and differences (RAF-indexed):
- Chain 't':
Compound: NADH:ubiquinone oxidoreductase subunit B9
Species: Ovis aries [TaxId:9940]
Database cross-references and differences (RAF-indexed):
- Chain 'u':
Compound: NADH:ubiquinone oxidoreductase subunit B2
Species: Ovis aries [TaxId:9940]
Database cross-references and differences (RAF-indexed):
- Chain 'v':
Compound: NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial
Species: Ovis aries [TaxId:9940]
Database cross-references and differences (RAF-indexed):
- Chain 'w':
Compound: Mitochondrial complex I, ESSS subunit
Species: Ovis aries [TaxId:9940]
Database cross-references and differences (RAF-indexed):
- Chain 'x':
Compound: Mitochondrial complex I, KFYI subunit
Species: Ovis aries [TaxId:9940]
Database cross-references and differences (RAF-indexed):
- Chain 'y':
Compound: Mitochondrial complex I, MNLL subunit
Species: Ovis aries [TaxId:9940]
Database cross-references and differences (RAF-indexed):
- Chain 'z':
Compound: Mitochondrial complex I, MWFE subunit
Species: Ovis aries [TaxId:9940]
Database cross-references and differences (RAF-indexed):
- Heterogens: 970, SF4, FMN, NAI, FES, K, 3PE, PC1, CDL, ZMP, ZN, NDP, AMP, MYR
PDB Chain Sequences:
- Chain '1':
Sequence, based on SEQRES records: (download)
>6zkn1 (1:)
mlaarrllggslparvsvrfsgdttapkktsfgslkdedriftnlygrhdwrlkgaqsrg
dwyktkeillkgpdwilgevktsglrgrggagfptglkwsfmnkpsdgrpkylvvnadeg
epgtckdreiirhdphklvegclvggramgaraayiyirgefyneasnlqvaireayeag
ligknacgsgydfdvfvvrgagayicgeetaliesiegkqgkprlkppfpadvgvfgcpt
tvanvetvavspticrrggawfasfgrernsgtklfnisghvnnpctveeemsvplkeli
ekhaggvtggwdnllavipggsstplipksvcetvlmdfdaliqaqtglgtaavivmdrs
tdivkaiarliefykhescgqctpcregvdwmnkvmarfvrgdarpaeidslweiskqie
ghticalgdgaawpvqglirhfrpeleermqrfaqqhqarqaas
Sequence, based on observed residues (ATOM records): (download)
>6zkn1 (1:)
ktsfgslkdedriftnlygrhdwrlkgaqsrgdwyktkeillkgpdwilgevktsglrgr
ggagfptglkwsfmnkpsdgrpkylvvnadegepgtckdreiirhdphklvegclvggra
mgaraayiyirgefyneasnlqvaireayeagligknacgsgydfdvfvvrgagayicge
etaliesiegkqgkprlkppfpadvgvfgcpttvanvetvavspticrrggawfasfgre
rnsgtklfnisghvnnpctveeemsvplkeliekhaggvtggwdnllavipggsstplip
ksvcetvlmdfdaliqaqtglgtaavivmdrstdivkaiarliefykhescgqctpcreg
vdwmnkvmarfvrgdarpaeidslweiskqieghticalgdgaawpvqglirhfrpelee
rmqrfaqqhq
- Chain '2':
No sequence available.
- Chain '3':
No sequence available.
- Chain '4':
No sequence available.
- Chain '5':
No sequence available.
- Chain '6':
No sequence available.
- Chain '9':
No sequence available.
- Chain 'A':
No sequence available.
- Chain 'H':
No sequence available.
- Chain 'J':
No sequence available.
- Chain 'K':
No sequence available.
- Chain 'L':
No sequence available.
- Chain 'M':
No sequence available.
- Chain 'N':
No sequence available.
- Chain 'V':
No sequence available.
- Chain 'W':
No sequence available.
- Chain 'X':
Sequence, based on SEQRES records: (download)
>6zknX (X:)
vevkdfyttnyqtavsfsplgpmpsmalmavslsganvpksggrpeesrvpvltqrkvpg
rvtplcrqysdappltlegikdrvlyvlklydkidpeklsvnshfmkdlgldsldqveii
mamedefgfeipdidaeklmcpqeivdyiadkkdvye
Sequence, based on observed residues (ATOM records): (download)
>6zknX (X:)
dappltlegikdrvlyvlklydkidpeklsvnshfmkdlgldsldqveiimamedefgfe
ipdidaeklmcpqeivdyiadkkdvye
- Chain 'Y':
No sequence available.
- Chain 'Z':
No sequence available.
- Chain 'a':
No sequence available.
- Chain 'b':
No sequence available.
- Chain 'c':
No sequence available.
- Chain 'd':
No sequence available.
- Chain 'e':
No sequence available.
- Chain 'f':
No sequence available.
- Chain 'g':
Sequence, based on SEQRES records: (download)
>6zkng (g:)
ngvelgsdflskmaasglrqaavaastsvkpifsrdmneakrrvrelyrawyrevpntvh
lfqldisvkqgrdkvremfkknahvtdprvvdllvikgkmeleetinvwkqrthvmrffh
eteaprpkdflskfyvghdp
Sequence, based on observed residues (ATOM records): (download)
>6zkng (g:)
tsvkpifsrdmneakrrvrelyrawyrevpntvhlfqldisvkqgrdkvremfkknahvt
dprvvdllvikgkmeleetinvwkqrthvmrffheteaprpkdflskfyvghdp
- Chain 'h':
No sequence available.
- Chain 'i':
No sequence available.
- Chain 'j':
Sequence, based on SEQRES records: (download)
>6zknj (j:)
vevkdfyttnyqtavsfsplgpmpsmalmavslsganvpksggrpeesrvpvltqrkvpg
rvtplcrqysdappltlegikdrvlyvlklydkidpeklsvnshfmkdlgldsldqveii
mamedefgfeipdidaeklmcpqeivdyiadkkdvye
Sequence, based on observed residues (ATOM records): (download)
>6zknj (j:)
pltlegikdrvlyvlklydkidpeklsvnshfmkdlgldsldqveiimamedefgfeipd
idaeklmcpqeivdyiadkkdv
- Chain 'k':
No sequence available.
- Chain 'l':
No sequence available.
- Chain 'm':
No sequence available.
- Chain 'n':
No sequence available.
- Chain 'o':
No sequence available.
- Chain 'p':
No sequence available.
- Chain 'q':
No sequence available.
- Chain 'r':
No sequence available.
- Chain 's':
No sequence available.
- Chain 't':
No sequence available.
- Chain 'u':
No sequence available.
- Chain 'v':
No sequence available.
- Chain 'w':
No sequence available.
- Chain 'x':
No sequence available.
- Chain 'y':
No sequence available.
- Chain 'z':
No sequence available.