PDB entry 6zkd

View 6zkd on RCSB PDB site
Description: Complex I during turnover, open1
Class: electron transport
Keywords: complex, respiration, NADH, proton pump, mitochondria, iron-sulphur cluster, oxidoreductase, membrane protein, ELECTRON TRANSPORT
Deposited on 2020-06-30, released 2020-10-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-11-11, with a file datestamp of 2020-11-06.
Experiment type: EM
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '1':
    Compound: nadh dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial
    Species: Ovis aries [TaxId:9940]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6zkd11, d6zkd12, d6zkd13
  • Chain '2':
    Compound: Mitochondrial complex I, 24 kDa subunit
    Species: Ovis aries [TaxId:9940]
    Database cross-references and differences (RAF-indexed):
  • Chain '3':
    Compound: NADH:ubiquinone oxidoreductase core subunit S1
    Species: Ovis aries [TaxId:9940]
    Database cross-references and differences (RAF-indexed):
  • Chain '4':
    Compound: Mitochondrial complex I, 49 kDa subunit
    Species: Ovis aries [TaxId:9940]
    Database cross-references and differences (RAF-indexed):
    • PDB 6ZKD (Start-462)
  • Chain '5':
    Compound: NADH:ubiquinone oxidoreductase core subunit S3
    Species: Ovis aries [TaxId:9940]
    Database cross-references and differences (RAF-indexed):
  • Chain '6':
    Compound: Mitochondrial complex I, PSST subunit
    Species: Ovis aries [TaxId:9940]
    Database cross-references and differences (RAF-indexed):
    • PDB 6ZKD (Start-222)
  • Chain '9':
    Compound: Mitochondrial complex I, TYKY subunit
    Species: Ovis aries [TaxId:9940]
    Database cross-references and differences (RAF-indexed):
    • PDB 6ZKD (Start-216)
  • Chain 'A':
    Compound: NADH-ubiquinone oxidoreductase chain 3
    Species: Ovis aries [TaxId:9940]
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: NADH-ubiquinone oxidoreductase chain 1
    Species: Ovis aries [TaxId:9940]
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: NADH-ubiquinone oxidoreductase chain 6
    Species: Ovis aries [TaxId:9940]
    Database cross-references and differences (RAF-indexed):
  • Chain 'K':
    Compound: NADH-ubiquinone oxidoreductase chain 4L
    Species: Ovis aries [TaxId:9940]
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: NADH-ubiquinone oxidoreductase chain 5
    Species: Ovis aries [TaxId:9940]
    Database cross-references and differences (RAF-indexed):
  • Chain 'M':
    Compound: NADH-ubiquinone oxidoreductase chain 4
    Species: Ovis aries [TaxId:9940]
    Database cross-references and differences (RAF-indexed):
  • Chain 'N':
    Compound: NADH-ubiquinone oxidoreductase chain 2
    Species: Ovis aries [TaxId:9940]
    Database cross-references and differences (RAF-indexed):
  • Chain 'V':
    Compound: Mitochondrial complex I, B14.7 subunit
    Species: Ovis aries [TaxId:9940]
    Database cross-references and differences (RAF-indexed):
  • Chain 'W':
    Compound: NADH:ubiquinone oxidoreductase subunit B5
    Species: Ovis aries [TaxId:9940]
    Database cross-references and differences (RAF-indexed):
  • Chain 'X':
    Compound: Acyl carrier protein
    Species: Ovis aries [TaxId:9940]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6zkdx_
  • Chain 'Y':
    Compound: nadh dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8
    Species: Ovis aries [TaxId:9940]
    Database cross-references and differences (RAF-indexed):
  • Chain 'Z':
    Compound: Mitochondrial complex I, PDSW subunit
    Species: Ovis aries [TaxId:9940]
    Database cross-references and differences (RAF-indexed):
    • PDB 6ZKD
  • Chain 'a':
    Compound: Mitochondrial complex I, 10 kDa subunit
    Species: Ovis aries [TaxId:9940]
    Database cross-references and differences (RAF-indexed):
    • PDB 6ZKD (Start-108)
  • Chain 'b':
    Compound: Mitochondrial complex I, 13 kDa subunit
    Species: Ovis aries [TaxId:9940]
    Database cross-references and differences (RAF-indexed):
    • PDB 6ZKD
  • Chain 'c':
    Compound: NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial
    Species: Ovis aries [TaxId:9940]
    Database cross-references and differences (RAF-indexed):
  • Chain 'd':
    Compound: NADH:ubiquinone oxidoreductase subunit A9
    Species: Ovis aries [TaxId:9940]
    Database cross-references and differences (RAF-indexed):
  • Chain 'e':
    Compound: nadh dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2
    Species: Ovis aries [TaxId:9940]
    Database cross-references and differences (RAF-indexed):
  • Chain 'f':
    Compound: Mitochondrial complex I, B13 subunit
    Species: Ovis aries [TaxId:9940]
    Database cross-references and differences (RAF-indexed):
  • Chain 'g':
    Compound: NADH:ubiquinone oxidoreductase subunit A6
    Species: Ovis aries [TaxId:9940]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6zkdg_
  • Chain 'h':
    Compound: Mitochondrial complex I, B14.5a subunit
    Species: Ovis aries [TaxId:9940]
    Database cross-references and differences (RAF-indexed):
  • Chain 'i':
    Compound: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12
    Species: Ovis aries [TaxId:9940]
    Database cross-references and differences (RAF-indexed):
  • Chain 'j':
    Compound: Acyl carrier protein
    Species: Ovis aries [TaxId:9940]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6zkdj_
  • Chain 'k':
    Compound: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial
    Species: Ovis aries [TaxId:9940]
    Database cross-references and differences (RAF-indexed):
  • Chain 'l':
    Compound: NADH:ubiquinone oxidoreductase subunit S5
    Species: Ovis aries [TaxId:9940]
    Database cross-references and differences (RAF-indexed):
  • Chain 'm':
    Compound: NADH:ubiquinone oxidoreductase subunit A3
    Species: Ovis aries [TaxId:9940]
    Database cross-references and differences (RAF-indexed):
  • Chain 'n':
    Compound: NADH:ubiquinone oxidoreductase subunit B3
    Species: Ovis aries [TaxId:9940]
    Database cross-references and differences (RAF-indexed):
  • Chain 'o':
    Compound: NADH dehydrogenase [ubiquinone] 1 subunit C2
    Species: Ovis aries [TaxId:9940]
    Database cross-references and differences (RAF-indexed):
  • Chain 'p':
    Compound: NADH:ubiquinone oxidoreductase subunit B4
    Species: Ovis aries [TaxId:9940]
    Database cross-references and differences (RAF-indexed):
  • Chain 'q':
    Compound: Mitochondrial complex I, B16.6 subunit
    Species: Ovis aries [TaxId:9940]
    Database cross-references and differences (RAF-indexed):
    • PDB 6ZKD (Start-143)
  • Chain 'r':
    Compound: Mitochondrial complex I, B17 subunit
    Species: Ovis aries [TaxId:9940]
    Database cross-references and differences (RAF-indexed):
  • Chain 's':
    Compound: NADH:ubiquinone oxidoreductase subunit B7
    Species: Ovis aries [TaxId:9940]
    Database cross-references and differences (RAF-indexed):
  • Chain 't':
    Compound: NADH:ubiquinone oxidoreductase subunit B9
    Species: Ovis aries [TaxId:9940]
    Database cross-references and differences (RAF-indexed):
  • Chain 'u':
    Compound: NADH:ubiquinone oxidoreductase subunit B2
    Species: Ovis aries [TaxId:9940]
    Database cross-references and differences (RAF-indexed):
  • Chain 'v':
    Compound: NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial
    Species: Ovis aries [TaxId:9940]
    Database cross-references and differences (RAF-indexed):
  • Chain 'w':
    Compound: Mitochondrial complex I, ESSS subunit
    Species: Ovis aries [TaxId:9940]
    Database cross-references and differences (RAF-indexed):
  • Chain 'x':
    Compound: Mitochondrial complex I, KFYI subunit
    Species: Ovis aries [TaxId:9940]
    Database cross-references and differences (RAF-indexed):
    • PDB 6ZKD (Start-75)
  • Chain 'y':
    Compound: Mitochondrial complex I, MNLL subunit
    Species: Ovis aries [TaxId:9940]
    Database cross-references and differences (RAF-indexed):
    • PDB 6ZKD (Start-57)
  • Chain 'z':
    Compound: Mitochondrial complex I, MWFE subunit
    Species: Ovis aries [TaxId:9940]
    Database cross-references and differences (RAF-indexed):
    • PDB 6ZKD (0-69)
  • Heterogens: SF4, FMN, NAI, FES, K, 3PE, PC1, DCQ, CDL, ZMP, ZN, NDP, AMP, MYR

PDB Chain Sequences:

  • Chain '1':
    Sequence, based on SEQRES records: (download)
    >6zkd1 (1:)
    mlaarrllggslparvsvrfsgdttapkktsfgslkdedriftnlygrhdwrlkgaqsrg
    dwyktkeillkgpdwilgevktsglrgrggagfptglkwsfmnkpsdgrpkylvvnadeg
    epgtckdreiirhdphklvegclvggramgaraayiyirgefyneasnlqvaireayeag
    ligknacgsgydfdvfvvrgagayicgeetaliesiegkqgkprlkppfpadvgvfgcpt
    tvanvetvavspticrrggawfasfgrernsgtklfnisghvnnpctveeemsvplkeli
    ekhaggvtggwdnllavipggsstplipksvcetvlmdfdaliqaqtglgtaavivmdrs
    tdivkaiarliefykhescgqctpcregvdwmnkvmarfvrgdarpaeidslweiskqie
    ghticalgdgaawpvqglirhfrpeleermqrfaqqhqarqaas
    

    Sequence, based on observed residues (ATOM records): (download)
    >6zkd1 (1:)
    ktsfgslkdedriftnlygrhdwrlkgaqsrgdwyktkeillkgpdwilgevktsglrgr
    ggagfptglkwsfmnkpsdgrpkylvvnadegepgtckdreiirhdphklvegclvggra
    mgaraayiyirgefyneasnlqvaireayeagligknacgsgydfdvfvvrgagayicge
    etaliesiegkqgkprlkppfpadvgvfgcpttvanvetvavspticrrggawfasfgre
    rnsgtklfnisghvnnpctveeemsvplkeliekhaggvtggwdnllavipggsstplip
    ksvcetvlmdfdaliqaqtglgtaavivmdrstdivkaiarliefykhescgqctpcreg
    vdwmnkvmarfvrgdarpaeidslweiskqieghticalgdgaawpvqglirhfrpelee
    rmqrfaqqhq
    

  • Chain '2':
    No sequence available.

  • Chain '3':
    No sequence available.

  • Chain '4':
    No sequence available.

  • Chain '5':
    No sequence available.

  • Chain '6':
    No sequence available.

  • Chain '9':
    No sequence available.

  • Chain 'A':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.

  • Chain 'M':
    No sequence available.

  • Chain 'N':
    No sequence available.

  • Chain 'V':
    No sequence available.

  • Chain 'W':
    No sequence available.

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >6zkdX (X:)
    vevkdfyttnyqtavsfsplgpmpsmalmavslsganvpksggrpeesrvpvltqrkvpg
    rvtplcrqysdappltlegikdrvlyvlklydkidpeklsvnshfmkdlgldsldqveii
    mamedefgfeipdidaeklmcpqeivdyiadkkdvye
    

    Sequence, based on observed residues (ATOM records): (download)
    >6zkdX (X:)
    dappltlegikdrvlyvlklydkidpeklsvnshfmkdlgldsldqveiimamedefgfe
    ipdidaeklmcpqeivdyiadkkdvye
    

  • Chain 'Y':
    No sequence available.

  • Chain 'Z':
    No sequence available.

  • Chain 'a':
    No sequence available.

  • Chain 'b':
    No sequence available.

  • Chain 'c':
    No sequence available.

  • Chain 'd':
    No sequence available.

  • Chain 'e':
    No sequence available.

  • Chain 'f':
    No sequence available.

  • Chain 'g':
    Sequence, based on SEQRES records: (download)
    >6zkdg (g:)
    ngvelgsdflskmaasglrqaavaastsvkpifsrdmneakrrvrelyrawyrevpntvh
    lfqldisvkqgrdkvremfkknahvtdprvvdllvikgkmeleetinvwkqrthvmrffh
    eteaprpkdflskfyvghdp
    

    Sequence, based on observed residues (ATOM records): (download)
    >6zkdg (g:)
    tsvkpifsrdmneakrrvrelyrawyrevpntvhlfqldisvkqgrdkvremfkknahvt
    dprvvdllvikgkmeleetinvwkqrthvmrffheteaprpkdflskfyvghdp
    

  • Chain 'h':
    No sequence available.

  • Chain 'i':
    No sequence available.

  • Chain 'j':
    Sequence, based on SEQRES records: (download)
    >6zkdj (j:)
    vevkdfyttnyqtavsfsplgpmpsmalmavslsganvpksggrpeesrvpvltqrkvpg
    rvtplcrqysdappltlegikdrvlyvlklydkidpeklsvnshfmkdlgldsldqveii
    mamedefgfeipdidaeklmcpqeivdyiadkkdvye
    

    Sequence, based on observed residues (ATOM records): (download)
    >6zkdj (j:)
    pltlegikdrvlyvlklydkidpeklsvnshfmkdlgldsldqveiimamedefgfeipd
    idaeklmcpqeivdyiadkkdv
    

  • Chain 'k':
    No sequence available.

  • Chain 'l':
    No sequence available.

  • Chain 'm':
    No sequence available.

  • Chain 'n':
    No sequence available.

  • Chain 'o':
    No sequence available.

  • Chain 'p':
    No sequence available.

  • Chain 'q':
    No sequence available.

  • Chain 'r':
    No sequence available.

  • Chain 's':
    No sequence available.

  • Chain 't':
    No sequence available.

  • Chain 'u':
    No sequence available.

  • Chain 'v':
    No sequence available.

  • Chain 'w':
    No sequence available.

  • Chain 'x':
    No sequence available.

  • Chain 'y':
    No sequence available.

  • Chain 'z':
    No sequence available.