PDB entry 6zil

View 6zil on RCSB PDB site
Description: Structure of the isolated REC domain of RcsB from Salmonella enterica serovar Typhimurium in the apo form
Class: DNA binding protein
Keywords: response regulator, phosphorylation, two-component systems, transcriptional factor, DNA BINDING PROTEIN
Deposited on 2020-06-26, released 2021-02-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-03-10, with a file datestamp of 2021-03-05.
Experiment type: XRAY
Resolution: 3.12 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: Transcriptional regulatory protein RcsB
    Species: Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) [TaxId:99287]
    Gene: rcsB, STM2270
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6zilb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6zilB (B:)
    mnnmnviiaddhpivlfgirksleqiewvnvvgefedstalinnlpkldahvlitdlsmp
    gdkygdgitlikyikrhfpslsiivltmnnnpailsavldldiegivlkqgaptdlpkal
    aalqkgkkftpesvsrllekisa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6zilB (B:)
    nmnviiaddhpivlfgirksleqiewvnvvgefedstalinnlpkldahvlitdlsmgdg
    itlikyikrhfpslsiivltmnnnpailsavldldiegivlkqgaptdlpkalaalqkgk
    kftpesvsrllek