SCOPe 2.08: Structural Classification of Proteins

PDB entry 6zhb

View 6zhb on RCSB PDB site
Description: 3d electron diffraction structure of bovine insulin
Deposited on 2020-06-22, released 2021-01-27
The last revision was dated 2021-01-27, with a file datestamp of 2021-01-22.
Experiment type: ELECTRONCRYSTALLOGRAPHY
Resolution: 3.25 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: insulin
Species: Bos taurus [TaxId:9913]
Database cross-references and differences (RAF-indexed):
- Uniprot P01317 (0-20)
Chain 'B':
Compound: insulin
Species: Bos taurus [TaxId:9913]
Database cross-references and differences (RAF-indexed):
- Uniprot P01317 (0-End)
Chain 'C':
Compound: insulin
Species: Bos taurus [TaxId:9913]
Database cross-references and differences (RAF-indexed):
- Uniprot P01317 (0-20)
Chain 'D':
Compound: insulin
Species: Bos taurus [TaxId:9913]
Database cross-references and differences (RAF-indexed):
- Uniprot P01317 (Start-29)
Heterogens: ZN

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

Chain 'A':
Sequence; same for both SEQRES and ATOM records:
```
>6zhbA (A:)
giveqccasvcslyqlenycn
```
Chain 'B':
Sequence, based on SEQRES records:
```
>6zhbB (B:)
fvnqhlcgshlvealylvcgergffytpka
```
Sequence, based on observed residues (ATOM records):
```
>6zhbB (B:)
fvnqhlcgshlvealylvcgergffytp
```
Chain 'C':
Sequence; same for both SEQRES and ATOM records:
```
>6zhbC (C:)
giveqccasvcslyqlenycn
```
Chain 'D':
Sequence, based on SEQRES records:
```
>6zhbD (D:)
fvnqhlcgshlvealylvcgergffytpka
```
Sequence, based on observed residues (ATOM records):
```
>6zhbD (D:)
vnqhlcgshlvealylvcgergffytpka
```