PDB entry 6zcv

View 6zcv on RCSB PDB site
Description: Crystal structure of lanthanide-dependent alcohol dehydrogenase PedH from Pseudomonas putida KT2440
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 2020-06-12, released 2020-07-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-07-15, with a file datestamp of 2020-07-10.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: quinoprotein ethanol dehydrogenase
    Species: Pseudomonas putida KT2440 [TaxId:160488]
    Gene: qedH-II, PP_2679
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q88JH0
      • engineered mutation (411)
      • engineered mutation (560)
    Domains in SCOPe 2.07: d6zcva_
  • Heterogens: PQQ, PR, CA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6zcvA (A:)
    mtrsprrplfavslvlsamllagaahaavsneeilqdpknpqqivtnglgvqgqryspld
    llnvnnvkelrpvwafsfggekqrgqqaqplikdgvmyltgsysrvfavdartgkklwqy
    darlpddirpccdvinrgvalygnlvffgtldaklvalnkdtgkvvwskkvadhkegysi
    saapmivngklitgvaggefgvvgkiqaynpengellwmrptveghmgyvykdgkaieng
    isggeagktwpgdlwktggaapwlggyydpetnlilfgtgnpapwnshlrpgdnlysssr
    lalnpddgtikwhfqstphdgwdfdgvnelisfnykdggkevkaaatadrngffyvldrt
    ngkfirgfpfvdkitwatgldkdgrpiyndasrpgapgseakgssvfvapavlgaknwmp
    maynkdtglfyvpsnewgmdiwnegiaykkgaaflgagftikplnedyigvlraidpvsg
    kevwrhknyaplwggvlttkgnlvftgtpegflqafnaktgdkvwefqtgsgvlgspvtw
    emdgeqyvsvvsgwggavplaggevakrvkdfnqggmlwtfklpkqlqqtasvkphhhhh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >6zcvA (A:)
    avsneeilqdpknpqqivtnglgvqgqryspldllnvnnvkelrpvwafsfggekqrgqq
    aqplikdgvmyltgsysrvfavdartgkklwqydarlpddirpccdvinrgvalygnlvf
    fgtldaklvalnkdtgkvvwskkvadhkegysisaapmivngklitgvaggefgvvgkiq
    aynpengellwmrptveghmgyvykdgkaiengisggeagktwpgdlwktggaapwlggy
    ydpetnlilfgtgnpapwnshlrpgdnlysssrlalnpddgtikwhfqstphdgwdfdgv
    nelisfnykdggkevkaaatadrngffyvldrtngkfirgfpfvdkitwatgldkdgrpi
    yndasrpgapgseakgssvfvapavlgaknwmpmaynkdtglfyvpsnewgmdiwnegia
    ykkgaaflgagftikplnedyigvlraidpvsgkevwrhknyaplwggvlttkgnlvftg
    tpegflqafnaktgdkvwefqtgsgvlgspvtwemdgeqyvsvvsgwggavplaggevak
    rvkdfnqggmlwtfklpkqlqq