PDB entry 6zc7

View 6zc7 on RCSB PDB site
Description: Small-molecule inhibitors of the PDZ domain of Dishevelled proteins interrupt Wnt signalling
Class: peptide binding protein
Keywords: PDZ, DVL, Inhibitors, Wnt, signalling, PEPTIDE BINDING PROTEIN
Deposited on 2020-06-09, released 2021-06-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-06-23, with a file datestamp of 2021-06-18.
Experiment type: XRAY
Resolution: 1.48 Å
R-factor: N/A
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dishevelled, dsh homolog 3 (Drosophila), isoform CRA_b
    Species: Homo sapiens [TaxId:9606]
    Gene: DKFZp586M1622, DVL3, hCG_40299
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UG07 (Start-93)
      • expression tag (94)
    Domains in SCOPe 2.08: d6zc7a1, d6zc7a2
  • Chain 'B':
    Compound: Dishevelled, dsh homolog 3 (Drosophila), isoform CRA_b
    Species: Homo sapiens [TaxId:9606]
    Gene: DKFZp586M1622, DVL3, hCG_40299
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UG07 (1-93)
      • expression tag (94)
    Domains in SCOPe 2.08: d6zc7b1, d6zc7b2
  • Heterogens: V31, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >6zc7A (A:)
amslniitvtlnmekynflgisivgqsnergdggiyigsimkggavaadgriepgdmllq
vneinfenmsnddavrvlreivhkpgpitltvaks

    Sequence, based on observed residues (ATOM records): (download) 
    >6zc7A (A:)
slniitvtlnmekynflgisivgqsergdggiyigsimkggavaadgriepgdmllqvne
infenmsnddavrvlreivhkpgpitltvaks

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >6zc7B (B:)
amslniitvtlnmekynflgisivgqsnergdggiyigsimkggavaadgriepgdmllq
vneinfenmsnddavrvlreivhkpgpitltvaks

    Sequence, based on observed residues (ATOM records): (download) 
    >6zc7B (B:)
mslniitvtlnmekynflgisivgqsnergdggiyigsimkggavaadgriepgdmllqv
neinfenmsnddavrvlreivhkpgpitltvaks