PDB entry 6zbk

View 6zbk on RCSB PDB site
Description: Crystal structure of the human complexe between RPAP3 and TRBP
Class: RNA binding protein
Keywords: RNPs, MicroRNAs, RNA Induced Silencing Complex, dsRNA pathways, RNA BINDING PROTEIN
Deposited on 2020-06-08, released 2021-06-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-06-30, with a file datestamp of 2021-06-25.
Experiment type: XRAY
Resolution: 1.49 Å
R-factor: N/A
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNA polymerase II-associated protein 3
    Species: Homo sapiens [TaxId:9606]
    Gene: RPAP3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6zbka_
  • Chain 'B':
    Compound: RISC-loading complex subunit TARBP2
    Species: Homo sapiens [TaxId:9606]
    Gene: TARBP2, TRBP
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6zbkA (A:)
    alvlkekgnkyfkqgkydeaidcytkgmdadpynpvlptnrasayfrlkkfavaesdcnl
    avalnrsytkaysrrgaarfalqkleeakkdyervlelepnnfeatnelrkisqalaske
    nsy
    

    Sequence, based on observed residues (ATOM records): (download)
    >6zbkA (A:)
    alvlkekgnkyfkqgkydeaidcytkgmdadpynpvlptnrasayfrlkkfavaesdcnl
    avalnrsytkaysrrgaarfalqkleeakkdyervlelepnnfeatnelrkisqala
    

  • Chain 'B':
    No sequence available.