PDB entry 6z98

View 6z98 on RCSB PDB site
Description: NMR solution structure of the peach allergen Pru p 1.0101
Class: allergen
Keywords: Peach Pru p 1 food allergen, Pathogenesis related protein, cross-allergy, ALLERGEN
Deposited on 2020-06-03, released 2021-06-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-06-30, with a file datestamp of 2021-06-25.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Major allergen Pru p 1
    Species: Prunus persica [TaxId:3760]
    Gene: ypr-10, PR10, PRUPE_1G128700, PRUPE_ppa012651mg
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6z98a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6z98A (A:)
gvftyeseftseippprlfkafvldadnlvpkiapqaikhseilegdggpgtikkitfge
gsqygyvkhkidsidkenhsysytliegdalgdnlekisyetklvaspsggsiikstshy
htkgdveikeehvkagkekasnlfklietylkghpdayn