PDB entry 6z4w

View 6z4w on RCSB PDB site
Description: FtsE structure from Streptococcus pneumoniae in complex with ADP (space group P 1)
Class: cell cycle
Keywords: Cell division, divisome, FtsEX, ATP-binding protein, CELL CYCLE
Deposited on 2020-05-26, released 2020-09-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-09-16, with a file datestamp of 2020-09-11.
Experiment type: XRAY
Resolution: 1.36 Å
R-factor: N/A
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cell division ATP-binding protein FtsE
    Species: Streptococcus pneumoniae [TaxId:1313]
    Gene: ftsE_1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6z4wa_
  • Heterogens: ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6z4wA (A:)
msiiemrdvvkkydngttalrgvsvsvqpgefayivgpsgagkstfirslyrevkidkgs
lsvagfnlvkikkkdvpllrrsvgvvfqdykllpkktvyeniayamevigenrrnikrrv
mevldlvglkhkvrsfpnelsggeqqriaiaraivnnpkvliadeptgnldpdnsweimn
llerinlqgttilmathnsqivntlrhrviaiengrvvrdeskgeygydd