PDB entry 6z3h

View 6z3h on RCSB PDB site
Description: Repulsive Guidance Molecule B (RGMB) in complex with Growth Differentiation Factor 5 (GDF5) (crystal form 2)
Class: signaling protein
Keywords: Repulsive Guidance Molecule, RGM, Bone Morphogenetic Protein, BMP, Growth Differentiation Factor 5, GDF5, Neogenin, axon guidance, TGFbeta signalling, brain development, iron metabolism., SIGNALING PROTEIN
Deposited on 2020-05-20, released 2020-07-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-15, with a file datestamp of 2020-07-10.
Experiment type: XRAY
Resolution: 3.16 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Growth/differentiation factor 5
  Species: Homo sapiens [TaxId:9606]
  Gene: GDF5, BMP14, CDMP1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P43026 (Start-116)
  Domains in SCOPe 2.08: d6z3ha_
• Chain 'B':
  Compound: rgm domain family member b
  Species: Homo sapiens [TaxId:9606]
  Gene: RGMB
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q6NW40 (3-End)

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >6z3hA (A:)
  mkrqgkrpsknlkarcsrkalhvnfkdmgwddwiiapleyeafhceglcefplrshlept
  nhaviqtlmnsmdpestpptccvptrlspisilfidsannvvykqyedmvvescgcr
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >6z3hA (A:)
  karcsrkalhvnfkdmgwddwiiapleyeafhceglcefplrshleptnhaviqtlmnsm
  dpestpptccvptrlspisilfidsannvvykqyedmvvescgcr
  

  
  
• Chain 'B':
  No sequence available.