PDB entry 6z2t

View 6z2t on RCSB PDB site
Description: three-dimensional structure of an influenza hemagglutinin lah protein in its post-fusion conformation
Deposited on 2020-05-18, released 2021-06-02
The last revision was dated 2021-06-02, with a file datestamp of 2021-05-28.
Experiment type: XRAY
Resolution: 1.34 Å
R-factor: N/A
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/Mexico City/63/2009(H1N1)) [TaxId:654771]
    Database cross-references and differences (RAF-indexed):
    • Uniprot C6KNC6 (1-End)
      • initiating methionine (0)
  • Heterogens: PO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6z2tA (A:)
    mekrienlnkkvddgfldiwtynaellvllenertldyhdsnvknlyekvrsqlknna
    

    Sequence, based on observed residues (ATOM records):
    >6z2tA (A:)
    mekrienlnkkvddgfldiwtynaellvllenertldyhdsnvknlyekvrsqlknn