PDB entry 6z1o

View 6z1o on RCSB PDB site
Description: al amyloid fibril from a lambda 3 light chain in conformation a
Deposited on 2020-05-14, released 2021-02-24
The last revision was dated 2021-02-24, with a file datestamp of 2021-02-19.
Experiment type: EM
Resolution: 3.2 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lambda 3 immunoglobulin light chain fragment, residues 2-116
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6Z1O (0-88)
  • Chain 'B':
    Compound: lambda 3 immunoglobulin light chain fragment, residues 2-116
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6Z1O (0-88)
  • Chain 'C':
    Compound: lambda 3 immunoglobulin light chain fragment, residues 2-116
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6Z1O (0-88)
  • Chain 'D':
    Compound: lambda 3 immunoglobulin light chain fragment, residues 2-116
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6Z1O (0-88)
  • Chain 'E':
    Compound: lambda 3 immunoglobulin light chain fragment, residues 2-116
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6Z1O (0-88)
  • Chain 'F':
    Compound: lambda 3 immunoglobulin light chain fragment, residues 2-116
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6Z1O (0-88)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6z1oA (A:)
avsvalgqtvritcqgdslrsysaswyqqkpgqapvlvifrrfsgsssgntasltitgaq
aedeadyycnsrdssanhqvfgggtkltv

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >6z1oB (B:)
avsvalgqtvritcqgdslrsysaswyqqkpgqapvlvifrrfsgsssgntasltitgaq
aedeadyycnsrdssanhqvfgggtkltv

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records:
    >6z1oC (C:)
avsvalgqtvritcqgdslrsysaswyqqkpgqapvlvifrrfsgsssgntasltitgaq
aedeadyycnsrdssanhqvfgggtkltv

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records:
    >6z1oD (D:)
avsvalgqtvritcqgdslrsysaswyqqkpgqapvlvifrrfsgsssgntasltitgaq
aedeadyycnsrdssanhqvfgggtkltv

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records:
    >6z1oE (E:)
avsvalgqtvritcqgdslrsysaswyqqkpgqapvlvifrrfsgsssgntasltitgaq
aedeadyycnsrdssanhqvfgggtkltv

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records:
    >6z1oF (F:)
avsvalgqtvritcqgdslrsysaswyqqkpgqapvlvifrrfsgsssgntasltitgaq
aedeadyycnsrdssanhqvfgggtkltv