PDB entry 6z0h

View 6z0h on RCSB PDB site
Description: structure of trem2 transmembrane helix k186a variant in dpc micelles
Deposited on 2020-05-08, released 2020-09-16
The last revision was dated 2020-10-28, with a file datestamp of 2020-10-23.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Triggering receptor expressed on myeloid cells 2
    Species: Homo sapiens [TaxId:9606]
    Gene: TREM2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NZC2 (3-48)
      • engineered mutation (28)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6z0hA (A:)
    gsgrsllegeipfpptsillllacifliailaasalwaaawhgqkpgth
    

    Sequence, based on observed residues (ATOM records):
    >6z0hA (A:)
    rsllegeipfpptsillllacifliailaasalwaaawhgqkpgth