PDB entry 6yxd

View 6yxd on RCSB PDB site
Description: Room temperature structure of human adiponectin receptor 2 (ADIPOR2) at 2.9 A resolution determined by Serial Crystallography (SSX) using CrystalDirect
Class: membrane protein
Keywords: Adiponectin receptor, ADIPOR, serial synchrotron crystallography, SSX, CrystalDirect, LCP crystallization, in meso, Membrane proteins, MEMBRANE PROTEIN
Deposited on 2020-05-01, released 2021-05-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-05-12, with a file datestamp of 2021-05-07.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Adiponectin receptor protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: ADIPOR2, PAQR2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q86V24 (5-End)
      • expression tag (3-4)
  • Chain 'H':
    Compound: V region heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6YXD (0-118)
    Domains in SCOPe 2.08: d6yxdh_
  • Chain 'L':
    Compound: V region light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6YXD (0-106)
    Domains in SCOPe 2.08: d6yxdl_
  • Heterogens: OLA, OLB, ZN, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6yxdH (H:)
evllqqsgpelvkpgasvritckasgytftdfnmdwvkqspgkslewigdfnpnsggsiy
nqkfkdkatftvdkssstaymelrsltfedtavyycaretgtawfaywgqgtlvtvsaa

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6yxdL (L:)
diqmtqspaslsasvgetvtitcrasgnihnflawyqqkqgkspqvlvynaktladgvps
rfsgsgsgtqyslkinslqpedfgsyycqqfwstpytfgggtklein