PDB entry 6yx9

View 6yx9 on RCSB PDB site
Description: Cryogenic human adiponectin receptor 2 (ADIPOR2) at 2.4 A resolution determined by Serial Crystallography (SSX) using CrystalDirect
Class: membrane protein
Keywords: Adiponectin receptor, ADIPOR2, serial synchrotron crystallography, SSX, CrystalDirect, LCP crystallization, in meso, MEMBRANE PROTEIN
Deposited on 2020-04-30, released 2021-05-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2021-05-12, with a file datestamp of 2021-05-07.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Adiponectin receptor protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: ADIPOR2, PAQR2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q86V24 (5-End)
      • expression tag (3-4)
  • Chain 'H':
    Compound: V region heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6YX9 (0-120)
    Domains in SCOPe 2.07: d6yx9h_
  • Chain 'L':
    Compound: V region light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6YX9 (0-107)
    Domains in SCOPe 2.07: d6yx9l_
  • Heterogens: GOL, OLA, OLB, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6yx9H (H:)
evllqqsgpelvkpgasvritckasgytftdfnmdwvkqspgkslewigdfnpnsggsiy
nqkfkdkatftvdkssstaymelrsltfedtavyycaretgtawfaywgqgtlvtvsaag
g

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6yx9L (L:)
sdiqmtqspaslsasvgetvtitcrasgnihnflawyqqkqgkspqvlvynaktladgvp
srfsgsgsgtqyslkinslqpedfgsyycqqfwstpytfgggtklein