PDB entry 6yx2

View 6yx2 on RCSB PDB site
Description: crystal structure of shank1 pdz in complex with a peptide-small molecule hybrid
Deposited on 2020-04-30, released 2021-01-20
The last revision was dated 2021-07-07, with a file datestamp of 2021-07-02.
Experiment type: XRAY
Resolution: 1.62 Å
R-factor: N/A
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: SH3 and multiple ankyrin repeat domains protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: shank1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y566 (3-111)
      • expression tag (0-2)
  • Chain 'B':
    Compound: SH3 and multiple ankyrin repeat domains protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: shank1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y566 (3-111)
      • expression tag (0-2)
  • Chain 'C':
    Compound: pww-thr-arg-leu
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 6YX2 (0-2)
  • Chain 'D':
    Compound: pww-thr-arg-leu
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 6YX2 (0-2)
  • Heterogens: PWW, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6yx2A (A:)
gplgsdyiikektvllqkkdsegfgfvlrgakaqtpieeftptpafpalqylesvdeggv
awraglrmgdflievngqnvvkvghrqvvnmirqggntlmvkvvmvtrhpdm

    Sequence, based on observed residues (ATOM records):
    >6yx2A (A:)
gplgsdyiikektvllqkkdsegfgfvlrgakeftptpafpalqylesvdeggvawragl
rmgdflievngqnvvkvghrqvvnmirqggntlmvkvvmvtrh

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6yx2B (B:)
gplgsdyiikektvllqkkdsegfgfvlrgakaqtpieeftptpafpalqylesvdeggv
awraglrmgdflievngqnvvkvghrqvvnmirqggntlmvkvvmvtrhpdm

    Sequence, based on observed residues (ATOM records):
    >6yx2B (B:)
gplgsdyiikektvllqkkdsegfgfvlrgakaqtpieeftptpafpalqylesvdeggv
awraglrmgdflievngqnvvkvghrqvvnmirqggntlmvkvvmvtrhpd

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records:
    >6yx2C (C:)
trl

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records:
    >6yx2D (D:)
trl