PDB entry 6yqw

View 6yqw on RCSB PDB site
Description: BRD9 with 4-chloro-2-methyl-methylamino-pyridazinone
Class: transcription
Keywords: brd9, inhibitor, histone, epigenetic reader, bromodomain, transcription
Deposited on 2020-04-18, released 2021-04-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-04-14, with a file datestamp of 2021-04-09.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bromodomain-containing protein 9
    Species: Homo sapiens [TaxId:9606]
    Gene: BRD9, UNQ3040/PRO9856
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6yqwa_
  • Heterogens: 82I, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >6yqwA (A:)
gaenestpiqqllehflrqlqrkdphgffafpvtdaiapgysmiikhpmdfgtmkdkiva
neyksvtefkadfklmcdnamtynrpdtvyyklakkilhagfkmms

    Sequence, based on observed residues (ATOM records): (download) 
    >6yqwA (A:)
stpiqqllehflrqlqrkdphgffafpvtdaiapgysmiikhpmdfgtmkdkivaneyks
vtefkadfklmcdnamtynrpdtvyyklakkilhagfkmms