PDB entry 6ypd

View 6ypd on RCSB PDB site
Description: Crystal structure of AmpC from E. coli with Cyclic Boronate 3 (CB3 / APC308)
Class: hydrolase
Keywords: beta lactamase, antibiotic resistance, bicyclic boronate, HYDROLASE
Deposited on 2020-04-15, released 2020-06-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-09-30, with a file datestamp of 2020-09-25.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-lactamase
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: ampC, ampA, b4150, JW4111
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6ypda_
  • Heterogens: KL8, PEG, DMS, EDO, CL, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6ypdA (A:)
apqqindivhrtitplieqqkipgmavaviyqgkpyyftwgyadiakkqpvtqqtlfelg
svsktftgvlggdaiargeiklsdpttkywpeltakqwngitllhlatytagglplqvpd
evksssdllrfyqnwqpawapgtqrlyanssiglfgalavkpsglsfeqamqtrvfqplk
lnhtwinvppaeeknyawgyregkavhvspgaldaeaygvkstiedmarwvqsnlkpldi
nektlqqgiqlaqsrywqtgdmyqglgwemldwpvnpdsiingsdnkialaarpvkaitp
ptpavraswvhktgatggfgsyvafipekelgivmlanknypnparvdaawqilnalq